SNAI1 (англ. Snail family transcriptional repressor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. Довжина поліпептидного ланцюга білка становить 264 амінокислот, а молекулярна маса — 29 083.
SNAI1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | SNAI1, SLUGH2, SNA, SNAH, SNAIL, SNAIL1, dJ710H13.1, snail family zinc finger 1, snail family transcriptional repressor 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 604238 MGI: 98330 HomoloGene: 4363 GeneCards: SNAI1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 20: 49.98 – 49.99 Mb | Хр. 2: 167.38 – 167.38 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MPRSFLVRKP | SDPNRKPNYS | ELQDSNPEFT | FQQPYDQAHL | LAAIPPPEIL | ||||
NPTASLPMLI | WDSVLAPQAQ | PIAWASLRLQ | ESPRVAELTS | LSDEDSGKGS | ||||
QPPSPPSPAP | SSFSSTSVSS | LEAEAYAAFP | GLGQVPKQLA | QLSEAKDLQA | ||||
RKAFNCKYCN | KEYLSLGALK | MHIRSHTLPC | VCGTCGKAFS | RPWLLQGHVR | ||||
THTGEKPFSC | PHCSRAFADR | SNLRAHLQTH | SDVKKYQCQA | CARTFSRMSL | ||||
LHKHQESGCS | GCPR |
Кодований геном білок за функціями належить до , фосфопротеїнів. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.
Література
- Twigg S.R., Wilkie A.O.M. (1999). Characterisation of the human snail (SNAI1) gene and exclusion as a major disease gene in craniosynostosis. Hum. Genet. 105: 320—326. PMID 10543399 DOI:10.1007/s004399900143
- Paznekas W.A., Okajima K., Schertzer M., Wood S., Jabs E.W. (1999). Genomic organization, expression, and chromosome location of the human SNAIL gene (SNAI1) and a related processed pseudogene (SNAI1P). Genomics. 62: 42—49. PMID 10585766 DOI:10.1006/geno.1999.6010
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Yook J.I., Li X.Y., Ota I., Fearon E.R., Weiss S.J. (2005). Wnt-dependent regulation of the E-cadherin repressor snail. J. Biol. Chem. 280: 11740—11748. PMID 15647282 DOI:10.1074/jbc.M413878200
- Mingot J.M., Vega S., Maestro B., Sanz J.M., Nieto M.A. (2009). Characterization of Snail nuclear import pathways as representatives of C2H2 zinc finger transcription factors. J. Cell Sci. 122: 1452—1460. PMID 19386897 DOI:10.1242/jcs.041749
- Lim S.O., Kim H., Jung G. (2010). p53 inhibits tumor cell invasion via the degradation of snail protein in hepatocellular carcinoma. FEBS Lett. 584: 2231—2236. PMID 20385133 DOI:10.1016/j.febslet.2010.04.006
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 18 червня 2017. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 4 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
SNAI1 angl Snail family transcriptional repressor 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 264 aminokislot a molekulyarna masa 29 083 SNAI1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2Y48 3W5K 4QLIIdentifikatoriSimvoliSNAI1 SLUGH2 SNA SNAH SNAIL SNAIL1 dJ710H13 1 snail family zinc finger 1 snail family transcriptional repressor 1Zovnishni ID OMIM 604238 MGI 98330 HomoloGene 4363 GeneCards SNAI1Ontologiya genaMolekulyarna funkciya sequence specific DNA binding DNA binding RNA polymerase II transcription regulatory region sequence specific DNA binding zv yazuvannya z ionom metalu kinase binding GO 0001948 GO 0016582 protein binding GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specific nucleic acid binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific E box bindingKlitinna komponenta klitinne yadro citoplazma nukleoplazma pericentric heterochromatin gialoplazmaBiologichnij proces trophoblast giant cell differentiation roof of mouth development regulation of bicellular tight junction assembly positive regulation of cell migration GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II epithelial to mesenchymal transition involved in endocardial cushion formation negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage multicellular organism development negative regulation of vitamin D biosynthetic process GO 0060469 GO 0009371 positive regulation of transcription DNA templated negative regulation of DNA damage response signal transduction by p53 class mediator osteoblast differentiation negative regulation of cell differentiation involved in embryonic placenta development cartilage morphogenesis hair follicle morphogenesis left right pattern formation mesoderm development GO 0045996 negative regulation of transcription DNA templated cell migration GO 1901227 negative regulation of transcription by RNA polymerase II Notch signaling involved in heart development mesoderm formation Epitelialno mezenhimalnij perehid positive regulation of epithelial to mesenchymal transition heterochromatin organization aortic valve morphogenesisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6615 20613Ensembl ENSG00000124216 ENSMUSG00000042821UniProt O95863 Q02085RefSeq mRNK NM 005985NM 011427RefSeq bilok NP 005976NP 035557Lokus UCSC Hr 20 49 98 49 99 MbHr 2 167 38 167 38 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL NPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGS QPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQA RKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVR THTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSL LHKHQESGCSGCPR A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do fosfoproteyiniv Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku DNK Lokalizovanij u citoplazmi yadri LiteraturaTwigg S R Wilkie A O M 1999 Characterisation of the human snail SNAI1 gene and exclusion as a major disease gene in craniosynostosis Hum Genet 105 320 326 PMID 10543399 DOI 10 1007 s004399900143 Paznekas W A Okajima K Schertzer M Wood S Jabs E W 1999 Genomic organization expression and chromosome location of the human SNAIL gene SNAI1 and a related processed pseudogene SNAI1P Genomics 62 42 49 PMID 10585766 DOI 10 1006 geno 1999 6010 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Yook J I Li X Y Ota I Fearon E R Weiss S J 2005 Wnt dependent regulation of the E cadherin repressor snail J Biol Chem 280 11740 11748 PMID 15647282 DOI 10 1074 jbc M413878200 Mingot J M Vega S Maestro B Sanz J M Nieto M A 2009 Characterization of Snail nuclear import pathways as representatives of C2H2 zinc finger transcription factors J Cell Sci 122 1452 1460 PMID 19386897 DOI 10 1242 jcs 041749 Lim S O Kim H Jung G 2010 p53 inhibits tumor cell invasion via the degradation of snail protein in hepatocellular carcinoma FEBS Lett 584 2231 2236 PMID 20385133 DOI 10 1016 j febslet 2010 04 006PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 18 chervnya 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 4 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 20 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi