RHEB (англ. Ras homolog enriched in brain) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми. Довжина поліпептидного ланцюга білка становить 184 амінокислот, а молекулярна маса — 20 497.
RHEB | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | RHEB, RHEB2, Ras homolog enriched in brain, Ras homolog, mTORC1 binding | ||||||||||||||||
Зовнішні ІД | OMIM: 601293 MGI: 97912 HomoloGene: 123916 GeneCards: RHEB | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 7: 151.47 – 151.52 Mb | Хр. 5: 25.01 – 25.05 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MPQSKSRKIA | ILGYRSVGKS | SLTIQFVEGQ | FVDSYDPTIE | NTFTKLITVN | ||||
GQEYHLQLVD | TAGQDEYSIF | PQTYSIDING | YILVYSVTSI | KSFEVIKVIH | ||||
GKLLDMVGKV | QIPIMLVGNK | KDLHMERVIS | YEEGKALAES | WNAAFLESSA | ||||
KENQTAVDVF | RRIILEAEKM | DGAASQGKSS | CSVM |
Кодований геном білок за функцією належить до фосфопротеїнів. Білок має сайт для зв'язування з нуклеотидами, іонами металів, ГТФ, іоном магнію. Локалізований у цитоплазмі, мембрані, ендоплазматичному ретикулумі, апараті гольджі.
Література
- Gromov P.S., Madsen P., Tomerup N., Celis J.E. (1995). A novel approach for expression cloning of small GTPases: identification, tissue distribution and chromosome mapping of the human homolog of rheb. FEBS Lett. 377: 221—226. PMID 8543055 DOI:10.1016/0014-5793(95)01349-0
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Inoki K., Li Y., Xu T., Guan K.-L. (2003). Rheb GTPase is a direct target of TSC2 GAP activity and regulates mTOR signaling. Genes Dev. 17: 1829—1834. PMID 12869586 DOI:10.1101/gad.1110003
- Li Y., Inoki K., Guan K.-L. (2004). Biochemical and functional characterizations of small GTPase Rheb and TSC2 GAP activity. Mol. Cell. Biol. 24: 7965—7975. PMID 15340059 DOI:10.1128/MCB.24.18.7965-7975.2004
- Long X., Lin Y., Ortiz-Vega S., Yonezawa K., Avruch J. (2005). Rheb binds and regulates the mTOR kinase. Curr. Biol. 15: 702—713. PMID 15854902 DOI:10.1016/j.cub.2005.02.053
- Tee A.R., Blenis J., Proud C.G. (2005). Analysis of mTOR signaling by the small G-proteins, Rheb and RhebL1. FEBS Lett. 579: 4763—4768. PMID 16098514 DOI:10.1016/j.febslet.2005.07.054
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:10011 (англ.) . Процитовано 7 вересня 2017.
- (англ.) . Архів оригіналу за 13 вересня 2017. Процитовано 7 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
RHEB angl Ras homolog enriched in brain bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 7 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 184 aminokislot a molekulyarna masa 20 497 RHEBNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1XTQ 1XTR 1XTS 3SEA 3T5GIdentifikatoriSimvoliRHEB RHEB2 Ras homolog enriched in brain Ras homolog mTORC1 bindingZovnishni ID OMIM 601293 MGI 97912 HomoloGene 123916 GeneCards RHEBOntologiya genaMolekulyarna funkciya nucleotide binding zv yazuvannya z ionom metalu GO 0001948 GO 0016582 protein binding protein kinase binding magnesium ion binding GO 0006184 GTPase activity GTP binding GDP bindingKlitinna komponenta citoplazma gialoplazma kompleks Goldzhi endoplasmic reticulum membrane membrana Golgi membrane lysosomal membrane endoplazmatichnij retikulum spliceosomal complex ekzosoma sistema endomembran GO 0097483 GO 0097481 postsinaptichne ushilnennya klitinna membranaBiologichnij proces positive regulation of oligodendrocyte differentiation regulation of TOR signaling regulation of type B pancreatic cell development positive regulation of TOR signaling GO 0072468 signalna transdukciya regulation of macroautophagy negative regulation of cold induced thermogenesis small GTPase mediated signal transductionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6009 19744Ensembl ENSG00000106615 ENSMUSG00000028945UniProt Q15382 Q921J2RefSeq mRNK NM 005614NM 053075RefSeq bilok NP 005605NP 444305Lokus UCSC Hr 7 151 47 151 52 MbHr 5 25 01 25 05 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVN GQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIH GKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSA KENQTAVDVFRRIILEAEKMDGAASQGKSSCSVM A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Bilok maye sajt dlya zv yazuvannya z nukleotidami ionami metaliv GTF ionom magniyu Lokalizovanij u citoplazmi membrani endoplazmatichnomu retikulumi aparati goldzhi LiteraturaGromov P S Madsen P Tomerup N Celis J E 1995 A novel approach for expression cloning of small GTPases identification tissue distribution and chromosome mapping of the human homolog of rheb FEBS Lett 377 221 226 PMID 8543055 DOI 10 1016 0014 5793 95 01349 0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Inoki K Li Y Xu T Guan K L 2003 Rheb GTPase is a direct target of TSC2 GAP activity and regulates mTOR signaling Genes Dev 17 1829 1834 PMID 12869586 DOI 10 1101 gad 1110003 Li Y Inoki K Guan K L 2004 Biochemical and functional characterizations of small GTPase Rheb and TSC2 GAP activity Mol Cell Biol 24 7965 7975 PMID 15340059 DOI 10 1128 MCB 24 18 7965 7975 2004 Long X Lin Y Ortiz Vega S Yonezawa K Avruch J 2005 Rheb binds and regulates the mTOR kinase Curr Biol 15 702 713 PMID 15854902 DOI 10 1016 j cub 2005 02 053 Tee A R Blenis J Proud C G 2005 Analysis of mTOR signaling by the small G proteins Rheb and RhebL1 FEBS Lett 579 4763 4768 PMID 16098514 DOI 10 1016 j febslet 2005 07 054PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10011 angl Procitovano 7 veresnya 2017 angl Arhiv originalu za 13 veresnya 2017 Procitovano 7 veresnya 2017 Div takozhHromosoma 7 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi