RCC1 (англ. Regulator of chromosome condensation 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 421 амінокислот, а молекулярна маса — 44 969.
RCC1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | RCC1, CHC1, RCC1-I, SNHG3-regulator of chromosome condensation 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 179710 MGI: 1913989 HomoloGene: 55567 GeneCards: RCC1 | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 28.51 – 28.54 Mb | Хр. 4: 132.06 – 132.08 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MSPKRIAKRR | SPPADAIPKS | KKVKVSHRSH | STEPGLVLTL | GQGDVGQLGL | ||||
GENVMERKKP | ALVSIPEDVV | QAEAGGMHTV | CLSKSGQVYS | FGCNDEGALG | ||||
RDTSVEGSEM | VPGKVELQEK | VVQVSAGDSH | TAALTDDGRV | FLWGSFRDNN | ||||
GVIGLLEPMK | KSMVPVQVQL | DVPVVKVASG | NDHLVMLTAD | GDLYTLGCGE | ||||
QGQLGRVPEL | FANRGGRQGL | ERLLVPKCVM | LKSRGSRGHV | RFQDAFCGAY | ||||
FTFAISHEGH | VYGFGLSNYH | QLGTPGTESC | FIPQNLTSFK | NSTKSWVGFS | ||||
GGQHHTVCMD | SEGKAYSLGR | AEYGRLGLGE | GAEEKSIPTL | ISRLPAVSSV | ||||
ACGASVGYAV | TKDGRVFAWG | MGTNYQLGTG | QDEDAWSPVE | MMGKQLENRV | ||||
VLSVSSGGQH | TVLLVKDKEQ | S |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як клітинний цикл, поділ клітини, мітоз. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Bischoff F.R., Maier G., Tilz G., Ponstingl H. (1990). A 47-kDa human nuclear protein recognized by antikinetochore autoimmune sera is homologous with the protein encoded by RCC1, a gene implicated in onset of chromosome condensation. Proc. Natl. Acad. Sci. U.S.A. 87: 8617—8621. PMID 2236072 DOI:10.1073/pnas.87.21.8617
- Bischoff F.R., Ponstingl H. (1991). Catalysis of guanine nucleotide exchange on Ran by the mitotic regulator RCC1. Nature. 354: 80—82. PMID 1944575 DOI:10.1038/354080a0
- Neuhaus E.M., Mashukova A., Barbour J., Wolters D., Hatt H. (2006). Novel function of beta-arrestin2 in the nucleus of mature spermatozoa. J. Cell Sci. 119: 3047—3056. PMID 16820410 DOI:10.1242/jcs.03046
- Hao Y., Macara I.G. (2008). Regulation of chromatin binding by a conformational switch in the tail of the Ran exchange factor RCC1. J. Cell Biol. 182: 827—836. PMID 18762580 DOI:10.1083/jcb.200803110
- Renault L., Kuhlmann J., Henkel A., Wittinghofer A. (2001). Structural basis for guanine nucleotide exchange on Ran by the regulator of chromosome condensation (RCC1). Cell. 105: 245—255. PMID 11336674 DOI:10.1016/S0092-8674(01)00315-4
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1913 (англ.) . Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 17 серпня 2017. Процитовано 25 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
RCC1 angl Regulator of chromosome condensation 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 421 aminokislot a molekulyarna masa 44 969 RCC1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1A12 1I2M 5E1O 5E2A 5E1M 5E2B 5E1D 5E1BIdentifikatoriSimvoliRCC1 CHC1 RCC1 I SNHG3 regulator of chromosome condensation 1Zovnishni ID OMIM 179710 MGI 1913989 HomoloGene 55567 GeneCards RCC1Ontologiya genaMolekulyarna funkciya DNA binding guanyl nucleotide exchange factor activity GO 0031493 histone binding chromatin binding GO 0001948 GO 0016582 protein binding nucleosomal DNA binding nucleosome binding sulfate binding protein heterodimerization activityKlitinna komponenta citoplazma yaderna membrana nukleoplazma condensed nuclear chromosome klitinne yadro Hromatin hromosoma GO 0009327 protein containing complexBiologichnij proces chromosome segregation G1 phase GO 0043148 mitotic spindle organization podil klitini spindle assembly klitinnij cikl GO 0022415 viral process regulation of mitotic nuclear division protein heterotetramerization regulation of molecular function G1 S transition of mitotic cell cycleDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez1104 100088Ensembl ENSG00000180198 ENSMUSG00000028896UniProt P18754 Q5T081 Q8VE37RefSeq mRNK NM 001048194 NM 001048195 NM 001048199 NM 001269 NM 001381865NM 001381866NM 001197082 NM 133878RefSeq bilok NP 001041659 NP 001041660 NP 001041664 NP 001260 NP 001368794NP 001368795 NP 001041664 1 NP 001260 1NP 001184011 NP 598639Lokus UCSC Hr 1 28 51 28 54 MbHr 4 132 06 132 08 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQSA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinnij cikl podil klitini mitoz Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u citoplazmi yadri LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Bischoff F R Maier G Tilz G Ponstingl H 1990 A 47 kDa human nuclear protein recognized by antikinetochore autoimmune sera is homologous with the protein encoded by RCC1 a gene implicated in onset of chromosome condensation Proc Natl Acad Sci U S A 87 8617 8621 PMID 2236072 DOI 10 1073 pnas 87 21 8617 Bischoff F R Ponstingl H 1991 Catalysis of guanine nucleotide exchange on Ran by the mitotic regulator RCC1 Nature 354 80 82 PMID 1944575 DOI 10 1038 354080a0 Neuhaus E M Mashukova A Barbour J Wolters D Hatt H 2006 Novel function of beta arrestin2 in the nucleus of mature spermatozoa J Cell Sci 119 3047 3056 PMID 16820410 DOI 10 1242 jcs 03046 Hao Y Macara I G 2008 Regulation of chromatin binding by a conformational switch in the tail of the Ran exchange factor RCC1 J Cell Biol 182 827 836 PMID 18762580 DOI 10 1083 jcb 200803110 Renault L Kuhlmann J Henkel A Wittinghofer A 2001 Structural basis for guanine nucleotide exchange on Ran by the regulator of chromosome condensation RCC1 Cell 105 245 255 PMID 11336674 DOI 10 1016 S0092 8674 01 00315 4PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1913 angl Procitovano 25 serpnya 2017 angl Arhiv originalu za 17 serpnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi