RAB3A (англ. RAB3A, member RAS oncogene family) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 220 амінокислот, а молекулярна маса — 24 984.
RAB3A | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | RAB3A, member RAS oncogene family | ||||||||||||||||
Зовнішні ІД | OMIM: 179490 MGI: 97843 HomoloGene: 20629 GeneCards: RAB3A | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 19: 18.2 – 18.2 Mb | Хр. 8: 71.21 – 71.21 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MASATDSRYG | QKESSDQNFD | YMFKILIIGN | SSVGKTSFLF | RYADDSFTPA | ||||
FVSTVGIDFK | VKTIYRNDKR | IKLQIWDTAG | QERYRTITTA | YYRGAMGFIL | ||||
MYDITNEESF | NAVQDWSTQI | KTYSWDNAQV | LLVGNKCDME | DERVVSSERG | ||||
RQLADHLGFE | FFEASAKDNI | NVKQTFERLV | DVICEKMSES | LDTADPAVTG | ||||
AKQGPQLSDQ | QVPPHQDCAC |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, транспорт білків, екзоцитоз. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у клітинній мембрані, мембрані.
Література
- Sullivan M., Olsen A.S., Houslay M.D. (1999). Genomic organisation of the human cyclic AMP-specific phosphodiesterase PDE4C gene and its chromosomal localisation to 19p13.1, between RAB3A and JUND. Cell. Signal. 11: 735—742. PMID 10574328 DOI:10.1016/S0898-6568(99)00037-6
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Farnsworth C.C., Seabra M.C., Ericsson L.H., Gelb M.H., Glomset J.A. (1994). Rab geranylgeranyl transferase catalyzes the geranylgeranylation of adjacent cysteines in the small GTPases Rab1A, Rab3A, and Rab5A. Proc. Natl. Acad. Sci. U.S.A. 91: 11963—11967. PMID 7991565 DOI:10.1073/pnas.91.25.11963
- Zahraoui A., Touchot N., Chardin P., Tavitian A. (1989). The human Rab genes encode a family of GTP-binding proteins related to yeast YPT1 and SEC4 products involved in secretion. J. Biol. Chem. 264: 12394—12401. PMID 2501306
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 16 липня 2017. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 18 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до . |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
RAB3A angl RAB3A member RAS oncogene family bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 220 aminokislot a molekulyarna masa 24 984 RAB3AIdentifikatoriSimvoliRAB3A member RAS oncogene familyZovnishni ID OMIM 179490 MGI 97843 HomoloGene 20629 GeneCards RAB3AOntologiya genaMolekulyarna funkciya nucleotide binding ATPase binding GTP binding myosin V binding protein C terminus binding GO 0001948 GO 0016582 protein binding ATPase activator activity GTP dependent protein binding GO 0006184 GTPase activity GDP dissociation inhibitor bindingKlitinna komponenta extracellular vesicle endosoma clathrin sculpted monoamine transport vesicle membrane membrana Sinaptichni bulbashki klitinna membrana clathrin sculpted gamma aminobutyric acid transport vesicle membrane clathrin sculpted acetylcholine transport vesicle membrane akson terminal bouton Akrosoma vnutrishnoklitinna organela clathrin sculpted glutamate transport vesicle membrane gialoplazma secretory granule membrane anchored component of synaptic vesicle membrane vezikula GO 0009327 protein containing complex presynaptic active zone secretory granule perinuclear region of cytoplasmBiologichnij proces respiratory system process positive regulation of ATP dependent activity aksonogeneza lung development synaptic vesicle exocytosis regulation of short term neuronal synaptic plasticity evoked neurotransmitter secretion mitochondrion organization response to electrical stimulus post embryonic development constitutive secretory pathway maintenance of presynaptic active zone structure glutamate secretion regulation of exocytosis regulation of synaptic vesicle fusion to presynaptic active zone membrane neuromuscular synaptic transmission synaptic vesicle recycling sensory perception of touch protein transport positive regulation of exocytosis synaptic vesicle maturation GO 0010554 neurotransmitter secretion positive regulation of regulated secretory pathway ekzocitoz neutrophil degranulation posttranslyacijna modifikaciya GO 0015915 transport intracellular protein transport vesicle docking involved in exocytosis protein secretion Rab protein signal transduction protein localization to plasma membrane plasma membrane repair regulation of synaptic vesicle priming synaptic vesicle transport acrosomal vesicle exocytosis regulation of synaptic vesicle exocytosis calcium ion regulated exocytosis synaptic vesicle clusteringDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5864 19339Ensembl ENSG00000105649 ENSMUSG00000031840UniProt P20336 P63011RefSeq mRNK NM 002866NM 001166399 NM 009001 NM 001328047 NM 001378892 NM 001378893RefSeq bilok NP 002857 NP 002857 1NP 001159871 NP 001314976 NP 033027 NP 001365821 NP 001365822Lokus UCSC Hr 19 18 2 18 2 MbHr 8 71 21 71 21 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPA FVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFIL MYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERG RQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTG AKQGPQLSDQQVPPHQDCAC A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transport transport bilkiv ekzocitoz Bilok maye sajt dlya zv yazuvannya z nukleotidami GTF Lokalizovanij u klitinnij membrani membrani LiteraturaSullivan M Olsen A S Houslay M D 1999 Genomic organisation of the human cyclic AMP specific phosphodiesterase PDE4C gene and its chromosomal localisation to 19p13 1 between RAB3A and JUND Cell Signal 11 735 742 PMID 10574328 DOI 10 1016 S0898 6568 99 00037 6 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Farnsworth C C Seabra M C Ericsson L H Gelb M H Glomset J A 1994 Rab geranylgeranyl transferase catalyzes the geranylgeranylation of adjacent cysteines in the small GTPases Rab1A Rab3A and Rab5A Proc Natl Acad Sci U S A 91 11963 11967 PMID 7991565 DOI 10 1073 pnas 91 25 11963 Zahraoui A Touchot N Chardin P Tavitian A 1989 The human Rab genes encode a family of GTP binding proteins related to yeast YPT1 and SEC4 products involved in secretion J Biol Chem 264 12394 12401 PMID 2501306PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 16 lipnya 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 18 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij