POLR2D (англ. RNA polymerase II subunit D) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 142 амінокислот, а молекулярна маса — 16 311.
POLR2D | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | POLR2D, HSRBP4, HSRPB4, RBP4, RPB16, RNA polymerase II subunit B4, polymerase (RNA) II subunit D, RNA polymerase II subunit D, RPB4 | ||||||||||||||||
Зовнішні ІД | OMIM: 606017 MGI: 1916491 HomoloGene: 37968 GeneCards: POLR2D | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 127.84 – 127.86 Mb | Хр. 18: 31.92 – 31.93 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAAGGSDPRA | GDVEEDASQL | IFPKEFETAE | TLLNSEVHML | LEHRKQQNES | ||||
AEDEQELSEV | FMKTLNYTAR | FSRFKNRETI | ASVRSLLLQK | KLHKFELACL | ||||
ANLCPETAEE | SKALIPSLEG | RFEDEELQQI | LDDIQTKRSF | QY |
Задіяний у такому біологічному процесі як транскрипція. Локалізований у ядрі.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Kershnar E., Wu S.-Y., Chiang C.-M. (1998). Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes. J. Biol. Chem. 273: 34444—34453. PMID 9852112 DOI:10.1074/jbc.273.51.34444
- Meka H., Werner F., Cordell S.C., Onesti S., Brick P. (2005). Crystal structure and RNA binding of the Rpb4/Rpb7 subunits of human RNA polymerase II. Nucleic Acids Res. 33: 6435—6444. PMID 16282592 DOI:10.1093/nar/gki945
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 20 липня 2017. Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 19 серпня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
POLR2D angl RNA polymerase II subunit D bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 142 aminokislot a molekulyarna masa 16 311 POLR2DNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2C35 5IYD 5IY8 5IYC 5IY6 5IY7 5IYA 5IY9 5IYBIdentifikatoriSimvoliPOLR2D HSRBP4 HSRPB4 RBP4 RPB16 RNA polymerase II subunit B4 polymerase RNA II subunit D RNA polymerase II subunit D RPB4Zovnishni ID OMIM 606017 MGI 1916491 HomoloGene 37968 GeneCards POLR2DOntologiya genaMolekulyarna funkciya nucleotide binding DNA directed 5 3 RNA polymerase activity single stranded DNA binding katalitichna aktivnist single stranded RNA binding translation initiation factor bindingKlitinna komponenta P body RNK polimeraza II klitinne yadro nukleoplazma gialoplazma nuclear speck nuclear DNA directed RNA polymerase complex RNA polymerase complexBiologichnij proces mRNA splicing via spliceosome recruitment of 3 end processing factors to RNA polymerase II holoenzyme complex transcription elongation from RNA polymerase II promoter 7 methylguanosine mRNA capping transcription by RNA polymerase II nuclear transcribed mRNA catabolic process deadenylation dependent decay cell metabolism transcription coupled nucleotide excision repair transcription initiation from RNA polymerase II promoter positive regulation of translational initiation mRNA export from nucleus in response to heat stress fibroblast growth factor receptor signaling pathway snRNA transcription by RNA polymerase II RNA metabolic process GO 1905616 regulation of gene silencing by miRNA DNA templated transcription initiation transcription DNA templated somatic stem cell population maintenance positive regulation of viral transcriptionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5433 69241Ensembl ENSG00000144231 ENSMUSG00000024258UniProt O15514 Q9D7M8RefSeq mRNK NM 004805NM 027002 NM 001357480RefSeq bilok NP 004796NP 081278 NP 001344409Lokus UCSC Hr 2 127 84 127 86 MbHr 18 31 92 31 93 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNES AEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACL ANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Zadiyanij u takomu biologichnomu procesi yak transkripciya Lokalizovanij u yadri LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kershnar E Wu S Y Chiang C M 1998 Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope tagged subunits of the multiprotein complexes J Biol Chem 273 34444 34453 PMID 9852112 DOI 10 1074 jbc 273 51 34444 Meka H Werner F Cordell S C Onesti S Brick P 2005 Crystal structure and RNA binding of the Rpb4 Rpb7 subunits of human RNA polymerase II Nucleic Acids Res 33 6435 6444 PMID 16282592 DOI 10 1093 nar gki945PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 20 lipnya 2017 Procitovano 28 serpnya 2017 angl Arhiv originalu za 19 serpnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi