Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
NXT1 (англ. Nuclear transport factor 2 like export factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. Довжина поліпептидного ланцюга білка становить 140 амінокислот, а молекулярна маса — 15 847.
| NXT1 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | NXT1, MTR2, P15, nuclear transport factor 2 like export factor 1 | ||||||||||||||||
| Зовнішні ІД | OMIM: 605811 MGI: 1929619 HomoloGene: 8301 GeneCards: NXT1 | ||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
 | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 20: 23.35 – 23.35 Mb | Хр. 2: 148.51 – 148.52 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MASVDFKTYV | DQACRAAEEF | VNVYYTTMDK | RRRLLSRLYM | GTATLVWNGN | ||||
| AVSGQESLSE | FFEMLPSSEF | QISVVDCQPV | HDEATPSQTT | VLVVICGSVK | ||||
| FEGNKQRDFN | QNFILTAQAS | PSNTVWKIAS | DCFRFQDWAS |
Задіяний у таких біологічних процесах, як транспорт, транспорт білків, ацетилювання. Локалізований у цитоплазмі, ядрі.
Література
- Black B.E., Levesque L., Holaska J.M., Wood T.C., Paschal B.M. (1999). Identification of an NTF2-related factor that binds Ran-GTP and regulates nuclear protein export. Mol. Cell. Biol. 19: 8616—8624. PMID 10567585 DOI:10.1128/MCB.19.12.8616
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Katahira J., Inoue H., Hurt E., Yoneda Y. (2009). Adaptor Aly and co-adaptor Thoc5 function in the Tap-p15-mediated nuclear export of HSP70 mRNA. EMBO J. 28: 556—567. PMID 19165146 DOI:10.1038/emboj.2009.5
- Fribourg S., Braun I.C., Izaurralde E., Conti E. (2001). Structural basis for the recognition of a nucleoporin FG repeat by the NTF2-like domain of the TAP/p15 mRNA nuclear export factor. Mol. Cell. 8: 645—656. PMID 11583626 DOI:10.1016/S1097-2765(01)00348-3
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:15913 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 24 грудня 2016. Процитовано 12 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
NXT1 angl Nuclear transport factor 2 like export factor 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 140 aminokislot a molekulyarna masa 15 847 NXT1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1JKG 1JN5 4WYKIdentifikatoriSimvoliNXT1 MTR2 P15 nuclear transport factor 2 like export factor 1Zovnishni ID OMIM 605811 MGI 1929619 HomoloGene 8301 GeneCards NXT1Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein bindingKlitinna komponenta klitinne yadro nuclear speck yaderna pora nukleoplazma citoplazma gialoplazma nuclear pore central transport channelBiologichnij proces protein export from nucleus protein transport RNA export from nucleus mRNA export from nucleus protein import into nucleus nucleocytoplasmic transportDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez29107 56488Ensembl ENSG00000132661 ENSMUSG00000036992UniProt Q9UKK6 Q9QZV9RefSeq mRNK NM 013248NM 001110159 NM 019761RefSeq bilok NP 037380NP 001103629 NP 062735Lokus UCSC Hr 20 23 35 23 35 MbHr 2 148 51 148 52 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWASA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak transport transport bilkiv acetilyuvannya Lokalizovanij u citoplazmi yadri LiteraturaBlack B E Levesque L Holaska J M Wood T C Paschal B M 1999 Identification of an NTF2 related factor that binds Ran GTP and regulates nuclear protein export Mol Cell Biol 19 8616 8624 PMID 10567585 DOI 10 1128 MCB 19 12 8616 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Katahira J Inoue H Hurt E Yoneda Y 2009 Adaptor Aly and co adaptor Thoc5 function in the Tap p15 mediated nuclear export of HSP70 mRNA EMBO J 28 556 567 PMID 19165146 DOI 10 1038 emboj 2009 5 Fribourg S Braun I C Izaurralde E Conti E 2001 Structural basis for the recognition of a nucleoporin FG repeat by the NTF2 like domain of the TAP p15 mRNA nuclear export factor Mol Cell 8 645 656 PMID 11583626 DOI 10 1016 S1097 2765 01 00348 3PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 15913 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 24 grudnya 2016 Procitovano 12 veresnya 2017 Div takozhHromosoma 20Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi