Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

NTRK1 англ Neurotrophic receptor tyrosine kinase 1 білок який кодується однойменним геном розташованим у людей на коротк

NTRK1

NTRK1

NTRK1 (англ. Neurotrophic receptor tyrosine kinase 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 796 амінокислот, а молекулярна маса — 87 497.

NTRK1
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NTRK1, MTC, TRK, TRK1, TRKA, Trk-A, p140-TrkA, neurotrophic receptor tyrosine kinase 1
Зовнішні ІД OMIM: 191315 MGI: 97383 HomoloGene: 1898 GeneCards: NTRK1
Реагує на сполуку
entrectinib, altiratinib, milciclib
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
4914
18211
Ensembl
ENSG00000198400
ENSMUSG00000028072
UniProt
P04629
Q3UFB7
RefSeq (мРНК)
NM_002529
NM_001007792
NM_001012331
NM_001033124
RefSeq (білок)
NP_001007793
NP_001012331
NP_002520
NP_001028296
Локус (UCSC) Хр. 1: 156.82 – 156.88 Mb Хр. 3: 87.69 – 87.7 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRC
TRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVK
SGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPL
HCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQV
PNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLT
LANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQ
PTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDT
NSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGI
NRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDA
CVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEAS
ESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRD
LATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESIL
YRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPR
ACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG

Кодований геном білок за функціями належить до трансфераз, кіназ, рецепторів, , тирозинових протеїнкіназ. Задіяний у таких біологічних процесах як диференціація, нейрогенез. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у клітинній мембрані, мембрані, ендосомах.

Література

  • Martin-Zanca D., Oskam R., Mitra G., Copeland T.D., Barbacid M. (1989). Molecular and biochemical characterization of the human trk proto-oncogene. Mol. Cell. Biol. 9: 24—33. PMID 2927393 DOI:10.1128/MCB.9.1.24
  • Indo Y., Mardy S., Tsuruta M., Karim M.A., Matsuda I. (1997). Structure and organization of the human TRKA gene encoding a high affinity receptor for nerve growth factor. Jpn. J. Hum. Genet. 42: 343—351. PMID 9290260 DOI:10.1007/BF02766957
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Fujimoto M., Kitazawa R., Maeda S., Kitazawa S. (2005). Methylation adjacent to negatively regulating AP-1 site reactivates TrkA gene expression during cancer progression. Oncogene. 24: 5108—5118. PMID 15870692 DOI:10.1038/sj.onc.1208697
  • Martin-Zanca D., Hughes S.H., Barbacid M. (1986). A human oncogene formed by the fusion of truncated tropomyosin and protein tyrosine kinase sequences. Nature. 319: 743—748. PMID 2869410 DOI:10.1038/319743a0
  • Hempstead B.L., Martin-Zanca D., Kaplan D.R., Parada L.F., Chao M.V. (1991). High-affinity NGF binding requires coexpression of the trk proto-oncogene and the low-affinity NGF receptor. Nature. 350: 678—683. PMID 1850821 DOI:10.1038/350678a0

Примітки

  1. Сполуки, які фізично взаємодіють з Neurotrophic receptor tyrosine kinase 1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:8031 (англ.) . Процитовано 25 серпня 2017.
  5. (англ.) . Архів оригіналу за 2 вересня 2017. Процитовано 25 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

NTRK1 angl Neurotrophic receptor tyrosine kinase 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 796 aminokislot a molekulyarna masa 87 497 NTRK1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1HE7 1SHC 1WWA 1WWW 2IFG 4AOJ 4F0I 4GT5 4CRP 4PMM 4PMP 4PMS 4PMT 4YNE 4YPSIdentifikatoriSimvoliNTRK1 MTC TRK TRK1 TRKA Trk A p140 TrkA neurotrophic receptor tyrosine kinase 1Zovnishni ID OMIM 191315 MGI 97383 HomoloGene 1898 GeneCards NTRK1Reaguye na spolukuentrectinib altiratinib milciclib Ontologiya genaMolekulyarna funkciya neurotrophin binding GPI linked ephrin receptor activity neurotrophin receptor activity kinase activity ATP binding protein kinase activity kinase binding transferase activity protein homodimerization activity GO 0001948 GO 0016582 protein binding nucleotide binding nerve growth factor binding neurotrophin p75 receptor binding protein tyrosine kinase activity transmembrane receptor protein tyrosine kinase activity nerve growth factor receptor activityKlitinna komponenta citoplazma endosoma membrana late endosome membrane cell surface integral component of membrane late endosome early endosome membrane receptor complex klitinna membrana akson neuronal cell body early endosome integral component of plasma membrane dendrit nejrobiologiya GO 0016023 cytoplasmic vesicle Golgi membrane endosome membrane GO 0009327 protein containing complex recycling endosome recycling endosome membraneBiologichnij proces GO 1904089 negative regulation of neuron apoptotic process positive regulation of protein phosphorylation positive regulation of Ras protein signal transduction positive regulation of programmed cell death behavioral response to formalin induced pain detection of temperature stimulus involved in sensory perception of pain protein phosphorylation cirkadnij ritm positive regulation of ERK1 and ERK2 cascade B cell differentiation response to ethanol innervaciya negative regulation of cell population proliferation response to nicotine GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity positive regulation of synaptic transmission glutamatergic response to nutrient levels learning or memory protein autophosphorylation negative regulation of neuron death detection of mechanical stimulus involved in sensory perception of pain diferenciaciya klitin neurotrophin TRK receptor signaling pathway fosforilyuvannya cellular response to nicotine olfactory nerve development response to electrical stimulus Sertoli cell development mechanoreceptor differentiation nejrobiologiya rozvitku positive regulation of angiogenesis positive regulation of NF kappaB transcription factor activity response to axon injury sensory perception of pain response to radiation phosphatidylinositol mediated signaling sympathetic nervous system development ephrin receptor signaling pathway cellular response to growth factor stimulus GO 0010260 starinnya lyudini response to hydrostatic pressure response to activity axon guidance multicellular organism development axonogenesis involved in innervation positive regulation of neuron projection development programmed cell death involved in cell development positive regulation of synapse assembly transmembrane receptor protein tyrosine kinase signaling pathway microtubule based movement peptidyl tyrosine phosphorylation peptidyl tyrosine autophosphorylation nerve growth factor signaling pathway cellular response to nerve growth factor stimulus positive regulation of phosphatidylinositol 3 kinase signaling negative regulation of apoptotic process regulation of MAPK cascade positive regulation of MAPK cascade cellular response to amyloid betaDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4914 18211Ensembl ENSG00000198400 ENSMUSG00000028072UniProt P04629 Q3UFB7RefSeq mRNK NM 002529 NM 001007792 NM 001012331NM 001033124RefSeq bilok NP 001007793 NP 001012331 NP 002520NP 001028296Lokus UCSC Hr 1 156 82 156 88 MbHr 3 87 69 87 7 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRC TRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVK SGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPL HCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQV PNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLT LANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQ PTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDT NSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGI NRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDA CVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEAS ESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRD LATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESIL YRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPR ACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz kinaz receptoriv tirozinovih proteyinkinaz Zadiyanij u takih biologichnih procesah yak diferenciaciya nejrogenez Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami Lokalizovanij u klitinnij membrani membrani endosomah LiteraturaMartin Zanca D Oskam R Mitra G Copeland T D Barbacid M 1989 Molecular and biochemical characterization of the human trk proto oncogene Mol Cell Biol 9 24 33 PMID 2927393 DOI 10 1128 MCB 9 1 24 Indo Y Mardy S Tsuruta M Karim M A Matsuda I 1997 Structure and organization of the human TRKA gene encoding a high affinity receptor for nerve growth factor Jpn J Hum Genet 42 343 351 PMID 9290260 DOI 10 1007 BF02766957 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Fujimoto M Kitazawa R Maeda S Kitazawa S 2005 Methylation adjacent to negatively regulating AP 1 site reactivates TrkA gene expression during cancer progression Oncogene 24 5108 5118 PMID 15870692 DOI 10 1038 sj onc 1208697 Martin Zanca D Hughes S H Barbacid M 1986 A human oncogene formed by the fusion of truncated tropomyosin and protein tyrosine kinase sequences Nature 319 743 748 PMID 2869410 DOI 10 1038 319743a0 Hempstead B L Martin Zanca D Kaplan D R Parada L F Chao M V 1991 High affinity NGF binding requires coexpression of the trk proto oncogene and the low affinity NGF receptor Nature 350 678 683 PMID 1850821 DOI 10 1038 350678a0PrimitkiSpoluki yaki fizichno vzayemodiyut z Neurotrophic receptor tyrosine kinase 1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 8031 angl Procitovano 25 serpnya 2017 angl Arhiv originalu za 2 veresnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ