NGF (англ. Nerve growth factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 241 амінокислот, а молекулярна маса — 26 959.
NGF | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | NGF, Beta-HSAN5, NGFB, nerve growth factor | ||||||||||||||||
Зовнішні ІД | OMIM: 162030 MGI: 97321 HomoloGene: 1876 GeneCards: NGF | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 115.29 – 115.34 Mb | Хр. 3: 102.38 – 102.43 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MSMLFYTLIT | AFLIGIQAEP | HSESNVPAGH | TIPQAHWTKL | QHSLDTALRR | ||||
ARSAPAAAIA | ARVAGQTRNI | TVDPRLFKKR | RLRSPRVLFS | TQPPREAADT | ||||
QDLDFEVGGA | APFNRTHRSK | RSSSHPIFHR | GEFSVCDSVS | VWVGDKTTAT | ||||
DIKGKEVMVL | GEVNINNSVF | KQYFFETKCR | DPNPVDSGCR | GIDSKHWNSY | ||||
CTTTHTFVKA | LTMDGKQAAW | RFIRIDTACV | CVLSRKAVRR | A |
Кодований геном білок за функціями належить до інгібіторів протеаз, факторів росту, . Секретований назовні.
Література
- Ullrich A., Gray A., Berman C., Dull T.J. (1983). Human beta-nerve growth factor gene sequence highly homologous to that of mouse. Nature. 303: 821—825. PMID 6688123 DOI:10.1038/303821a0
- Kitano T., Liu Y.-H., Ueda S., Saitou N. (2004). Human-specific amino acid changes found in 103 protein-coding genes. Mol. Biol. Evol. 21: 936—944. PMID 15014171 DOI:10.1093/molbev/msh100
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Hallboeoek F., Ibanez C.F., Persson H. (1991). Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary. Neuron. 6: 845—858. PMID 2025430 DOI:10.1016/0896-6273(91)90180-8
- Klein R., Jing S., Nanduri V., O'Rourke E., Barbacid M. (1991). The trk proto-oncogene encodes a receptor for nerve growth factor. Cell. 65: 189—197. PMID 1849459 DOI:10.1016/0092-8674(91)90419-Y
- Wijeyewickrema L.C., Gardiner E.E., Gladigau E.L., Berndt M.C., Andrews R.K. (2010). Nerve growth factor inhibits metalloproteinase-disintegrins and blocks ectodomain shedding of platelet glycoprotein VI. J. Biol. Chem. 285: 11793—11799. PMID 20164177 DOI:10.1074/jbc.M110.100479
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 15 вересня 2015. Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 20 липня 2017. Процитовано 25 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
NGF angl Nerve growth factor bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 241 aminokislot a molekulyarna masa 26 959 NGFNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB4ZBN 1SG1 1WWW 2IFG 4EDW 4EDXIdentifikatoriSimvoliNGF Beta HSAN5 NGFB nerve growth factorZovnishni ID OMIM 162030 MGI 97321 HomoloGene 1876 GeneCards NGFOntologiya genaMolekulyarna funkciya peptidase inhibitor activity GO 0048551 enzyme inhibitor activity GO 0001948 GO 0016582 protein binding metalloendopeptidase inhibitor activity nerve growth factor receptor binding growth factor activity signaling receptor bindingKlitinna komponenta endosoma Golgi lumen extracellular region GO 0016023 cytoplasmic vesicle mizhklitinnij prostir gialoplazma Sinaptichni bulbashki akson dendrit nejrobiologiya Biologichnij proces GO 1904089 negative regulation of neuron apoptotic process regulation of neuron differentiation neuron projection morphogenesis negative regulation of peptidase activity neurotrophin TRK receptor signaling pathway cell cell signaling negative regulation of apoptotic process regulation of cysteine type endopeptidase activity involved in apoptotic process positive regulation of axonogenesis GO 1901313 positive regulation of gene expression positive regulation of apoptotic process nerve growth factor processing extrinsic apoptotic signaling pathway via death domain receptors phosphatidylinositol mediated signaling negative regulation of cysteine type endopeptidase activity involved in apoptotic process microtubule based movement activation of cysteine type endopeptidase activity involved in apoptotic process positive regulation of Ras protein signal transduction transmembrane receptor protein tyrosine kinase signaling pathway peripheral nervous system development pam yat negative regulation of cell population proliferation regulation of signaling receptor activity nerve development nerve growth factor signaling pathway positive regulation of DNA binding positive regulation of neuron differentiation positive regulation of collateral sprouting modulation of chemical synaptic transmissionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4803 18049Ensembl ENSG00000134259 ENSMUSG00000027859UniProt P01138 P01139RefSeq mRNK NM 002506NM 001112698 NM 013609RefSeq bilok NP 002497NP 001106168 NP 038637Lokus UCSC Hr 1 115 29 115 34 MbHr 3 102 38 102 43 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRAA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do ingibitoriv proteaz faktoriv rostu Sekretovanij nazovni LiteraturaUllrich A Gray A Berman C Dull T J 1983 Human beta nerve growth factor gene sequence highly homologous to that of mouse Nature 303 821 825 PMID 6688123 DOI 10 1038 303821a0 Kitano T Liu Y H Ueda S Saitou N 2004 Human specific amino acid changes found in 103 protein coding genes Mol Biol Evol 21 936 944 PMID 15014171 DOI 10 1093 molbev msh100 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Hallboeoek F Ibanez C F Persson H 1991 Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary Neuron 6 845 858 PMID 2025430 DOI 10 1016 0896 6273 91 90180 8 Klein R Jing S Nanduri V O Rourke E Barbacid M 1991 The trk proto oncogene encodes a receptor for nerve growth factor Cell 65 189 197 PMID 1849459 DOI 10 1016 0092 8674 91 90419 Y Wijeyewickrema L C Gardiner E E Gladigau E L Berndt M C Andrews R K 2010 Nerve growth factor inhibits metalloproteinase disintegrins and blocks ectodomain shedding of platelet glycoprotein VI J Biol Chem 285 11793 11799 PMID 20164177 DOI 10 1074 jbc M110 100479PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 15 veresnya 2015 Procitovano 25 serpnya 2017 angl Arhiv originalu za 20 lipnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi