NDUFA13 (англ. NADH:ubiquinone oxidoreductase subunit A13) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 144 амінокислот, а молекулярна маса — 16 698.
NDUFA13 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | NDUFA13, B16.6, CDA016, GRIM-19, GRIM19, CGI-39, NADH:ubiquinone oxidoreductase subunit A13, MC1DN28 | ||||||||||||||||
Зовнішні ІД | OMIM: 609435 MGI: 1914434 HomoloGene: 41083 GeneCards: NDUFA13 | ||||||||||||||||
Реагує на сполуку | |||||||||||||||||
метформін, metformin hydrochloride | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 19: 19.52 – 19.53 Mb | Хр. 8: 70.35 – 70.36 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAASKVKQDM | PPPGGYGPID | YKRNLPRRGL | SGYSMLAIGI | GTLIYGHWSI | ||||
MKWNRERRRL | QIEDFEARIA | LLPLLQAETD | RRTLQMLREN | LEEEAIIMKD | ||||
VPDWKVGESV | FHTTRWVPPL | IGELYGLRTT | EEALHASHGF | MWYT |
Задіяний у таких біологічних процесах, як апоптоз, транспорт, транспорт електронів, дихальний ланцюг, ацетилювання, альтернативний сплайсинг. Локалізований у ядрі, мембрані, мітохондрії, внутрішній мембрані мітохондрії.
Література
- Angell J.E., Lindner D.J., Shapiro P.S., Hofmann E.R., Kalvakolanu D.V. (2000). Identification of GRIM-19, a novel cell death-regulatory gene induced by the interferon-beta and retinoic acid combination, using a genetic approach. J. Biol. Chem. 275: 33416—33426. PMID 10924506 DOI:10.1074/jbc.M003929200
- Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C. (2000). Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. Genome Res. 10: 703—713. PMID 10810093 DOI:10.1101/gr.10.5.703
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Zhang X., Huang Q., Yang Z., Li Y., Li C.-Y. (2004). GW112, a novel antiapoptotic protein that promotes tumor growth. Cancer Res. 64: 2474—2481. PMID 15059901 DOI:10.1158/0008-5472.CAN-03-3443
Примітки
- Сполуки, які фізично взаємодіють з NADH:ubiquinone oxidoreductase subunit A13 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:17194 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 27 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
NDUFA13 angl NADH ubiquinone oxidoreductase subunit A13 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 144 aminokislot a molekulyarna masa 16 698 NDUFA13IdentifikatoriSimvoliNDUFA13 B16 6 CDA016 GRIM 19 GRIM19 CGI 39 NADH ubiquinone oxidoreductase subunit A13 MC1DN28Zovnishni ID OMIM 609435 MGI 1914434 HomoloGene 41083 GeneCards NDUFA13Reaguye na spolukumetformin metformin hydrochloride Ontologiya genaMolekulyarna funkciya NADH dehydrogenase ubiquinone activity GO 0001948 GO 0016582 protein binding ATP binding NADH dehydrogenase activityKlitinna komponenta citoplazma integral component of membrane mitohondrialna membrana membrana nukleoplazma mitohondriya mitochondrial respirasome mitohondrialna vnutrishnya membrana respirasome klitinne yadro mitochondrial respiratory chain complex IBiologichnij proces cellular response to retinoic acid protein insertion into mitochondrial inner membrane GO 1903364 positive regulation of protein catabolic process cellular response to interferon beta negative regulation of intrinsic apoptotic signaling pathway reactive oxygen species metabolic process positive regulation of peptidase activity positive regulation of cysteine type endopeptidase activity involved in apoptotic process negative regulation of cell growth apoptotic signaling pathway GO 0045996 negative regulation of transcription DNA templated GO 0097285 apoptoz extrinsic apoptotic signaling pathway mitochondrial respiratory chain complex I assembly mitochondrial electron transport NADH to ubiquinoneDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez51079 67184Ensembl ENSG00000186010 ENSMUSG00000036199UniProt Q9P0J0 Q9ERS2RefSeq mRNK NM 015965NM 023312 NM 001382215RefSeq bilok NP 057049NP 075801 1 NP 075801Lokus UCSC Hr 19 19 52 19 53 MbHr 8 70 35 70 36 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSI MKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKD VPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT A Alanin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak apoptoz transport transport elektroniv dihalnij lancyug acetilyuvannya alternativnij splajsing Lokalizovanij u yadri membrani mitohondriyi vnutrishnij membrani mitohondriyi LiteraturaAngell J E Lindner D J Shapiro P S Hofmann E R Kalvakolanu D V 2000 Identification of GRIM 19 a novel cell death regulatory gene induced by the interferon beta and retinoic acid combination using a genetic approach J Biol Chem 275 33416 33426 PMID 10924506 DOI 10 1074 jbc M003929200 Lai C H Chou C Y Ch ang L Y Liu C S Lin W C 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics Genome Res 10 703 713 PMID 10810093 DOI 10 1101 gr 10 5 703 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang X Huang Q Yang Z Li Y Li C Y 2004 GW112 a novel antiapoptotic protein that promotes tumor growth Cancer Res 64 2474 2481 PMID 15059901 DOI 10 1158 0008 5472 CAN 03 3443PrimitkiSpoluki yaki fizichno vzayemodiyut z NADH ubiquinone oxidoreductase subunit A13 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 17194 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 27 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi