Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

MYOD1 англ Myogenic differentiation 1 білок який кодується однойменним геном розташованим у людей на короткому плечі 11

MYOD1

MYOD1

MYOD1 (англ. Myogenic differentiation 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 320 амінокислот, а молекулярна маса — 34 501.

MYOD1
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYOD1, MYF3, MYOD, PUM, bHLHc1, myogenic differentiation 1, MYODRIF
Зовнішні ІД OMIM: 159970 MGI: 97275 HomoloGene: 7857 GeneCards: MYOD1
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
4654
17927
Ensembl
ENSG00000129152
ENSMUSG00000009471
UniProt
P15172
P10085
RefSeq (мРНК)
NM_002478
NM_010866
RefSeq (білок)
NP_002469
NP_034996
Локус (UCSC) Хр. 11: 17.72 – 17.72 Mb Хр. 7: 46.03 – 46.03 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRL
MHVGALLKPEEHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKA
CKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEIL
RNAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDAS
SPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLD
CLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQS
PDAAPQCPAGANPNPIYQVL

Кодований геном білок за функціями належить до активаторів, , фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, міогенез, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі. Втрата контролю над цим перемикачем може стати причиною утворення рабдоміосаркоми.

Література

  • Pearson-White S.H. (1991). Human MyoD: cDNA and deduced amino acid sequence. Nucleic Acids Res. 19: 1148—1148. PMID 1850513 DOI:10.1093/nar/19.5.1148
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Breitschopf K., Bengal E., Ziv T., Admon A., Ciechanover A. (1998). A novel site for ubiquitination: the N-terminal residue, and not internal lysines of MyoD, is essential for conjugation and degradation of the protein. EMBO J. 17: 5964—5973. PMID 9774340 DOI:10.1093/emboj/17.20.5964
  • McKinsey T.A., Zhang C.L., Olson E.N. (2001). Control of muscle development by dueling HATs and HDACs. Curr. Opin. Genet. Dev. 11: 497—504. PMID 11532390 DOI:10.1016/S0959-437X(00)00224-0
  • Mal A.K. (2006). Histone methyltransferase Suv39h1 represses MyoD-stimulated myogenic differentiation. EMBO J. 25: 3323—3334. PMID 16858404 DOI:10.1038/sj.emboj.7601229
  • Chen B., Dias P., Jenkins J.J. III, Savell V.H., Parham D.M. (1998). Methylation alterations of the MyoD1 upstream region are predictive of subclassification of human rhabdomyosarcomas. Am. J. Pathol. 152: 1071—1079. PMID 9546368

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:7611 (англ.) . Процитовано 8 вересня 2017.
  4. (англ.) . Архів оригіналу за 6 жовтня 2017. Процитовано 8 вересня 2017.
  5. https://www.worldcommunitygrid.org/about_us/article.s?articleId=783
  6. https://jcp.bmj.com/content/56/6/412

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

MYOD1 angl Myogenic differentiation 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 320 aminokislot a molekulyarna masa 34 501 MYOD1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1MDYIdentifikatoriSimvoliMYOD1 MYF3 MYOD PUM bHLHc1 myogenic differentiation 1 MYODRIFZovnishni ID OMIM 159970 MGI 97275 HomoloGene 7857 GeneCards MYOD1Ontologiya genaMolekulyarna funkciya DNA binding sequence specific DNA binding RNA polymerase II transcription regulatory region sequence specific DNA binding protein dimerization activity GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity transcription factor binding chromatin binding GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding E box binding GO 0001948 GO 0016582 protein binding protein heterodimerization activity enzyme binding transcription factor activity RNA polymerase II distal enhancer sequence specific binding chromatin DNA binding ubiquitin protein ligase binding GO 0001105 transcription coactivator activity GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific promoter specific chromatin bindingKlitinna komponenta transcription regulator complex nukleoplazma miofibrila klitinne yadro citoplazma gialoplazma yaderni tilcyaBiologichnij proces diferenciaciya klitin myotube differentiation GO 0009373 regulation of transcription DNA templated GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II cellular response to starvation muscle cell fate commitment cellular response to estradiol stimulus skeletal muscle fiber adaptation muscle organ development regulation of alternative mRNA splicing via spliceosome myotube cell development positive regulation of skeletal muscle fiber development negative regulation of myoblast proliferation transcription DNA templated multicellular organism development GO 0060469 GO 0009371 positive regulation of transcription DNA templated protein phosphorylation regulation of RNA splicing positive regulation of myoblast fusion myoblast fate determination cellular response to glucocorticoid stimulus positive regulation of myoblast differentiation skeletal muscle fiber development histone H3 acetylation myotube differentiation involved in skeletal muscle regeneration histone H4 acetylation skeletal muscle cell differentiation positive regulation of skeletal muscle tissue regeneration regulyaciya ekspresiyi geniv striated muscle cell differentiation cellular response to oxygen levels myoblast fusion myoblast differentiation skeletal muscle tissue development GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II transcription by RNA polymerase II positive regulation of muscle cell differentiation cellular response to tumor necrosis factor positive regulation of snRNA transcription by RNA polymerase IIDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4654 17927Ensembl ENSG00000129152 ENSMUSG00000009471UniProt P15172 P10085RefSeq mRNK NM 002478NM 010866RefSeq bilok NP 002469NP 034996Lokus UCSC Hr 11 17 72 17 72 MbHr 7 46 03 46 03 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRL MHVGALLKPEEHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKA CKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEIL RNAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDAS SPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLD CLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQS PDAAPQCPAGANPNPIYQVL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi diferenciaciya klitin miogenez acetilyuvannya Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri Vtrata kontrolyu nad cim peremikachem mozhe stati prichinoyu utvorennya rabdomiosarkomi LiteraturaPearson White S H 1991 Human MyoD cDNA and deduced amino acid sequence Nucleic Acids Res 19 1148 1148 PMID 1850513 DOI 10 1093 nar 19 5 1148 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Breitschopf K Bengal E Ziv T Admon A Ciechanover A 1998 A novel site for ubiquitination the N terminal residue and not internal lysines of MyoD is essential for conjugation and degradation of the protein EMBO J 17 5964 5973 PMID 9774340 DOI 10 1093 emboj 17 20 5964 McKinsey T A Zhang C L Olson E N 2001 Control of muscle development by dueling HATs and HDACs Curr Opin Genet Dev 11 497 504 PMID 11532390 DOI 10 1016 S0959 437X 00 00224 0 Mal A K 2006 Histone methyltransferase Suv39h1 represses MyoD stimulated myogenic differentiation EMBO J 25 3323 3334 PMID 16858404 DOI 10 1038 sj emboj 7601229 Chen B Dias P Jenkins J J III Savell V H Parham D M 1998 Methylation alterations of the MyoD1 upstream region are predictive of subclassification of human rhabdomyosarcomas Am J Pathol 152 1071 1079 PMID 9546368PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7611 angl Procitovano 8 veresnya 2017 angl Arhiv originalu za 6 zhovtnya 2017 Procitovano 8 veresnya 2017 https www worldcommunitygrid org about us article s articleId 783 https jcp bmj com content 56 6 412Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ