MGMT (англ. O-6-methylguanine-DNA methyltransferase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми. Довжина поліпептидного ланцюга білка становить 207 амінокислот, а молекулярна маса — 21 646.
MGMT | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | MGMT, Mgmt, AGT, AI267024, Agat, O-6-methylguanine-DNA methyltransferase | ||||||||||||||||
Зовнішні ІД | OMIM: 156569 MGI: 96977 HomoloGene: 31089 GeneCards: MGMT | ||||||||||||||||
2.1.1.63 | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 10: 129.47 – 129.77 Mb | Хр. 7: 136.5 – 136.73 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MDKDCEMKRT | TLDSPLGKLE | LSGCEQGLHE | IKLLGKGTSA | ADAVEVPAPA | ||||
AVLGGPEPLM | QCTAWLNAYF | HQPEAIEEFP | VPALHHPVFQ | QESFTRQVLW | ||||
KLLKVVKFGE | VISYQQLAAL | AGNPKAARAV | GGAMRGNPVP | ILIPCHRVVC | ||||
SSGAVGNYSG | GLAVKEWLLA | HEGHRLGKPG | LGGSSGLAGA | WLKGAGATSG | ||||
SPPAGRN |
Кодований геном білок за функціями належить до трансфераз, метилтрансфераз, фосфопротеїнів. Задіяний у таких біологічних процесах, як пошкодження ДНК, репарація ДНК. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.
Література
- Tano K., Shiota S., Collier J., Foote R.S., Mitra S. (1990). Isolation and structural characterization of a cDNA clone encoding the human DNA repair protein for O6-alkylguanine. Proc. Natl. Acad. Sci. U.S.A. 87: 686—690. PMID 2405387 DOI:10.1073/pnas.87.2.686
- Hayakawa H., Koike G., Sekiguchi M. (1990). Expression and cloning of complementary DNA for a human enzyme that repairs O6-methylguanine in DNA. J. Mol. Biol. 213: 739—747. PMID 2359121 DOI:10.1016/S0022-2836(05)80260-8
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Liem L.-K., Lim A., Li B.F.L. (1994). Specificities of human, rat and E. coli O6-methylguanine-DNA methyltransferases towards the repair of O6-methyl and O6-ethylguanine in DNA. Nucleic Acids Res. 22: 1613—1619. PMID 8202360 DOI:10.1093/nar/22.9.1613
- Kanugula S., Goodtzova K., Edara S., Pegg A.E. (1995). Alteration of arginine-128 to alanine abolishes the ability of human O6-alkylguanine-DNA alkyltransferase to repair methylated DNA but has no effect on its reaction with O6-benzylguanine. Biochemistry. 34: 7113—7119. PMID 7766621 DOI:10.1021/bi00021a024
- Edara S., Goodtzova K., Pegg A.E. (1995). The role of tyrosine-158 in O6-alkylguanine-DNA alkyltransferase activity. Carcinogenesis. 16: 1637—1642. PMID 7614699 DOI:10.1093/carcin/16.7.1637
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:7059 (англ.) . Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 8 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
MGMT angl O 6 methylguanine DNA methyltransferase bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 10 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 207 aminokislot a molekulyarna masa 21 646 MGMTNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1EH6 1EH7 1EH8 1QNT 1T38 1T39 1YFHIdentifikatoriSimvoliMGMT Mgmt AGT AI267024 Agat O 6 methylguanine DNA methyltransferaseZovnishni ID OMIM 156569 MGI 96977 HomoloGene 31089 GeneCards MGMT2 1 1 63Ontologiya genaMolekulyarna funkciya GO 0102674 GO 0102675 methyltransferase activity transferase activity DNA binding calcium ion binding DNA methyltransferase activity zv yazuvannya z ionom metalu katalitichna aktivnist methylated DNA protein cysteine S methyltransferase activity Klitinna komponenta membrana nukleoplazma klitinne yadroBiologichnij proces GO 1904578 response to organic cyclic compound GO 1900404 positive regulation of DNA repair GO 1904579 cellular response to organic cyclic compound negative regulation of cell death regulation of cysteine type endopeptidase activity involved in apoptotic process mammary gland epithelial cell differentiation cellular response to DNA damage stimulus DNA ligation Metilyuvannya cellular response to ionizing radiation cellular response to oxidative stress response to folic acid response to ethanol response to toxic substance positive regulation of double strand break repair GO 0100026 Reparaciya DNK Metilyuvannya DNK negative regulation of apoptotic process DNA dealkylation involved in DNA repairDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4255 17314Ensembl ENSG00000170430 ENSMUSG00000054612UniProt P16455 P26187RefSeq mRNK NM 002412NM 008598 NM 001377037RefSeq bilok NP 002403NP 032624 NP 001363966Lokus UCSC Hr 10 129 47 129 77 MbHr 7 136 5 136 73 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPA AVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLW KLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVC SSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSG SPPAGRN A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz metiltransferaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak poshkodzhennya DNK reparaciya DNK Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku DNK Lokalizovanij u yadri LiteraturaTano K Shiota S Collier J Foote R S Mitra S 1990 Isolation and structural characterization of a cDNA clone encoding the human DNA repair protein for O6 alkylguanine Proc Natl Acad Sci U S A 87 686 690 PMID 2405387 DOI 10 1073 pnas 87 2 686 Hayakawa H Koike G Sekiguchi M 1990 Expression and cloning of complementary DNA for a human enzyme that repairs O6 methylguanine in DNA J Mol Biol 213 739 747 PMID 2359121 DOI 10 1016 S0022 2836 05 80260 8 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Liem L K Lim A Li B F L 1994 Specificities of human rat and E coli O6 methylguanine DNA methyltransferases towards the repair of O6 methyl and O6 ethylguanine in DNA Nucleic Acids Res 22 1613 1619 PMID 8202360 DOI 10 1093 nar 22 9 1613 Kanugula S Goodtzova K Edara S Pegg A E 1995 Alteration of arginine 128 to alanine abolishes the ability of human O6 alkylguanine DNA alkyltransferase to repair methylated DNA but has no effect on its reaction with O6 benzylguanine Biochemistry 34 7113 7119 PMID 7766621 DOI 10 1021 bi00021a024 Edara S Goodtzova K Pegg A E 1995 The role of tyrosine 158 in O6 alkylguanine DNA alkyltransferase activity Carcinogenesis 16 1637 1642 PMID 7614699 DOI 10 1093 carcin 16 7 1637PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7059 angl Procitovano 8 veresnya 2017 angl Arhiv originalu za 25 serpnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 10 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi