Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

LYN англ LYN proto oncogene Src family tyrosine kinase білок який кодується однойменним геном розташованим у людей на ко

LYN

LYN

LYN (англ. LYN proto-oncogene, Src family tyrosine kinase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми. Довжина поліпептидного ланцюга білка становить 512 амінокислот, а молекулярна маса — 58 574.

LYN
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи LYN, LYN proto-oncogene, Src family tyrosine kinase, JTK8, p53Lyn, p56Lyn
Зовнішні ІД OMIM: 165120 MGI: 96892 HomoloGene: 55649 GeneCards: LYN
Реагує на сполуку
bafetinib, бозутиніб, SU6656
Ортологи
Види Людина Миша
Entrez
4067
17096
Ensembl
ENSG00000254087
ENSMUSG00000042228
UniProt
P07948
P25911
RefSeq (мРНК)
NM_001111097
NM_002350
NM_001111096
NM_010747
RefSeq (білок)
NP_001104567
NP_002341
NP_001104566
NP_034877
Локус (UCSC) Хр. 8: 55.88 – 56.01 Mb Хр. 4: 3.68 – 3.81 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQL
LPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWW
KAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSA
GAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRIT
FPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLV
KRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQ
IAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAR
EGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNA
DVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDF
YTATEGQYQQQP

Кодований геном білок за функціями належить до тирозинових протеїнкіназ родини Src-протеїнкіназ. Задіяний у таких біологічних процесах, як адаптивний імунітет, вроджений імунітет, взаємодія хазяїн-вірус, запальна відповідь. Білок має сайт для зв'язування з АТФ. Локалізований у клітинній мембрані, цитоплазмі, ядрі, апараті гольджі.

Література

  • Rider L.G., Raben N., Miller L., Jelsema C. (1994). The cDNAs encoding two forms of the LYN protein tyrosine kinase are expressed in rat mast cells and human myeloid cells. Gene. 138: 219—222. PMID 8125304 DOI:10.1016/0378-1119(94)90811-7
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Partanen J., Maekelae T.P., Alitalo R., Lehvaeslaiho H., Alitalo K. (1990). Putative tyrosine kinases expressed in K-562 human leukemia cells. Proc. Natl. Acad. Sci. U.S.A. 87: 8913—8917. PMID 2247464 DOI:10.1073/pnas.87.22.8913
  • Bielke W., Ziemiecki A., Kappos L., Miescher G.C. (1992). Expression of the B cell-associated tyrosine kinase gene Lyn in primary neuroblastoma tumours and its modulation during the differentiation of neuroblastoma cell lines. Biochem. Biophys. Res. Commun. 186: 1403—1409. PMID 1510669 DOI:10.1016/S0006-291X(05)81562-1
  • Roifman C.M., Ke S. (1993). CD19 is a substrate of the antigen receptor-associated protein tyrosine kinase in human B cells. Biochem. Biophys. Res. Commun. 194: 222—225. PMID 7687428 DOI:10.1006/bbrc.1993.1807
  • Wang A.V., Scholl P.R., Geha R.S. (1994). Physical and functional association of the high affinity immunoglobulin G receptor (Fc gamma RI) with the kinases Hck and Lyn. J. Exp. Med. 180: 1165—1170. PMID 8064233 DOI:10.1084/jem.180.3.1165

Примітки

  1. Сполуки, які фізично взаємодіють з LYN переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:6735 (англ.) . Процитовано 7 вересня 2017.
  5. (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 7 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

LYN angl LYN proto oncogene Src family tyrosine kinase bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 8 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 512 aminokislot a molekulyarna masa 58 574 LYNNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1W1F 1WA7 3A4OIdentifikatoriSimvoliLYN LYN proto oncogene Src family tyrosine kinase JTK8 p53Lyn p56LynZovnishni ID OMIM 165120 MGI 96892 HomoloGene 55649 GeneCards LYNReaguye na spolukubafetinib bozutinib SU6656 Ontologiya genaMolekulyarna funkciya transmembrane transporter binding SH3 domain binding GO 0032403 protein containing complex binding kinase activity gamma tubulin binding signaling receptor binding ATP binding protein kinase activity non membrane spanning protein tyrosine kinase activity enzyme binding transferase activity platelet derived growth factor receptor binding integrin binding GO 0001948 GO 0016582 protein binding glycosphingolipid binding protein tyrosine kinase activity nucleotide binding phosphoprotein binding ubiquitin protein ligase binding ephrin receptor binding phosphorylation dependent protein bindingKlitinna komponenta citoplazma gialoplazma membrana extrinsic component of cytoplasmic side of plasma membrane mitohondrialnij mizhmembrannij prostir perinuclear region of cytoplasm klitinne yadro mitohondrialna membrana membrane raft ekzosoma kompleks Goldzhi klitinna membrana GO 0097483 GO 0097481 postsinaptichne ushilnennya mast cell granule integrin alpha2 beta1 complex Krista vnutrishnoklitinna membranna organela glutamatergic synapse postsynaptic specialization intracellular componentBiologichnij proces regulation of protein phosphorylation cellular response to extracellular stimulus cellular response to retinoic acid positive regulation of B cell receptor signaling pathway tolerance induction to self antigen regulation of mast cell activation regulation of cell adhesion mediated by integrin cellular response to heat response to amino acid krovotvorennya adaptivna imunna vidpovid regulation of erythrocyte differentiation cellular response to DNA damage stimulus positive regulation of Fc receptor mediated stimulatory signaling pathway platelet activation Fc epsilon receptor signaling pathway protein phosphorylation regulation of B cell apoptotic process positive regulation of dendritic cell apoptotic process positive regulation of glial cell proliferation response to carbohydrate regulation of platelet aggregation negative regulation of cell population proliferation B cell receptor signaling pathway negative regulation of myeloid leukocyte differentiation dendritic cell differentiation Fc receptor mediated inhibitory signaling pathway Fc gamma receptor signaling pathway involved in phagocytosis transmembrane receptor protein tyrosine kinase signaling pathway regulation of B cell receptor signaling pathway stimulatory C type lectin receptor signaling pathway response to sterol depletion positive regulation of stress activated protein kinase signaling cascade GO 0032657 regulation of cytokine production response to insulin positive regulation of mast cell proliferation negative regulation of MAP kinase activity regulation of ERK1 and ERK2 cascade positive regulation of peptidyl tyrosine phosphorylation erythrocyte differentiation protein autophosphorylation oligodendrocyte development regulation of mast cell degranulation positive regulation of phosphorylation GO 0022415 viral process response to toxic substance GO 0033128 negative regulation of protein phosphorylation Fc receptor mediated stimulatory signaling pathway growth hormone receptor signaling pathway via JAK STAT fosforilyuvannya proces imunnoyi sistemi regulation of release of sequestered calcium ion into cytosol positive regulation of tyrosine phosphorylation of STAT protein B cell homeostasis immune response regulating cell surface receptor signaling pathway response to axon injury negative regulation of mast cell proliferation regulation of inflammatory response peptidyl tyrosine autophosphorylation response to hormone regulation of monocyte chemotaxis leukocyte migration lipopolysaccharide mediated signaling pathway histamine secretion by mast cell GO 0007243 intracellular signal transduction GO 1904578 response to organic cyclic compound negative regulation of intracellular signal transduction positive regulation of cell migration ephrin receptor signaling pathway negative regulation of toll like receptor 2 signaling pathway T cell costimulation response to peptide hormone platelet degranulation zsidannya krovi positive regulation of phosphatidylinositol 3 kinase activity positive regulation of oligodendrocyte progenitor proliferation negative regulation of immune response positive regulation of cell population proliferation positive regulation of neuron projection development negative regulation of ERK1 and ERK2 cascade peptidyl tyrosine phosphorylation negative regulation of B cell proliferation negative regulation of toll like receptor 4 signaling pathway GO 0072468 signalna transdukciya vrodzhenij imunitet neuron projection development central nervous system development inflammatory response positive regulation of protein phosphorylation positive regulation of phosphatidylinositol 3 kinase signaling diferenciaciya klitin positive regulation of Ras protein signal transduction positive regulation of aspartic type endopeptidase activity involved in amyloid precursor protein catabolic processDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez4067 17096Ensembl ENSG00000254087 ENSMUSG00000042228UniProt P07948 P25911RefSeq mRNK NM 001111097 NM 002350NM 001111096 NM 010747RefSeq bilok NP 001104567 NP 002341NP 001104566 NP 034877Lokus UCSC Hr 8 55 88 56 01 MbHr 4 3 68 3 81 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQL LPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWW KAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSA GAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRIT FPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLV KRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQ IAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAR EGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNA DVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDF YTATEGQYQQQP A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do tirozinovih proteyinkinaz rodini Src proteyinkinaz Zadiyanij u takih biologichnih procesah yak adaptivnij imunitet vrodzhenij imunitet vzayemodiya hazyayin virus zapalna vidpovid Bilok maye sajt dlya zv yazuvannya z ATF Lokalizovanij u klitinnij membrani citoplazmi yadri aparati goldzhi LiteraturaRider L G Raben N Miller L Jelsema C 1994 The cDNAs encoding two forms of the LYN protein tyrosine kinase are expressed in rat mast cells and human myeloid cells Gene 138 219 222 PMID 8125304 DOI 10 1016 0378 1119 94 90811 7 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Partanen J Maekelae T P Alitalo R Lehvaeslaiho H Alitalo K 1990 Putative tyrosine kinases expressed in K 562 human leukemia cells Proc Natl Acad Sci U S A 87 8913 8917 PMID 2247464 DOI 10 1073 pnas 87 22 8913 Bielke W Ziemiecki A Kappos L Miescher G C 1992 Expression of the B cell associated tyrosine kinase gene Lyn in primary neuroblastoma tumours and its modulation during the differentiation of neuroblastoma cell lines Biochem Biophys Res Commun 186 1403 1409 PMID 1510669 DOI 10 1016 S0006 291X 05 81562 1 Roifman C M Ke S 1993 CD19 is a substrate of the antigen receptor associated protein tyrosine kinase in human B cells Biochem Biophys Res Commun 194 222 225 PMID 7687428 DOI 10 1006 bbrc 1993 1807 Wang A V Scholl P R Geha R S 1994 Physical and functional association of the high affinity immunoglobulin G receptor Fc gamma RI with the kinases Hck and Lyn J Exp Med 180 1165 1170 PMID 8064233 DOI 10 1084 jem 180 3 1165PrimitkiSpoluki yaki fizichno vzayemodiyut z LYN pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6735 angl Procitovano 7 veresnya 2017 angl Arhiv originalu za 25 serpnya 2017 Procitovano 7 veresnya 2017 Div takozhHromosoma 8 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ