Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

JUN англ Jun proto oncogene AP 1 transcription factor subunit білок який кодується однойменним геном розташованим у люде

JUN

JUN

JUN (англ. Jun proto-oncogene, AP-1 transcription factor subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 331 амінокислот, а молекулярна маса — 35 676.

JUN
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи JUN, AP-1, AP1, c-Jun, Jun proto-oncogene, AP-1 transcription factor subunit, p39, cJUN
Зовнішні ІД OMIM: 165160 MGI: 96646 HomoloGene: 1679 GeneCards: JUN
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
3725
16476
Ensembl
ENSG00000177606
ENSMUSG00000052684
UniProt
P05412
P05627
RefSeq (мРНК)
NM_002228
NM_010591
RefSeq (білок)
NP_002219
NP_034721
Локус (UCSC) Хр. 1: 58.78 – 58.78 Mb Хр. 4: 94.94 – 94.94 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLK
PHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCP
KNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASV
AGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQ
PQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQ
ERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література

  • Hattori K., Angel P., le Beau M.M., Karin M. (1988). Structure and chromosomal localization of the functional intronless human JUN protooncogene. Proc. Natl. Acad. Sci. U.S.A. 85: 9148—9152. PMID 3194415 DOI:10.1073/pnas.85.23.9148
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Bannister A.J., Gottlieb T.M., Kouzarides T., Jackson S.P. (1993). c-Jun is phosphorylated by the DNA-dependent protein kinase in vitro; definition of the minimal kinase recognition motif. Nucleic Acids Res. 21: 1289—1295. PMID 8464713 DOI:10.1093/nar/21.5.1289
  • Enslen H., Tokumitsu H., Stork P.J., Davis R.J., Soderling T.R. (1996). Regulation of mitogen-activated protein kinases by a calcium/calmodulin-dependent protein kinase cascade. Proc. Natl. Acad. Sci. U.S.A. 93: 10803—10808. PMID 8855261 DOI:10.1073/pnas.93.20.10803
  • Kirstein M., Sanz L., Moscat J., Diaz-Meco M.T., Saus J. (1996). Cross-talk between different enhancer elements during mitogenic induction of the human stromelysin-1 gene. J. Biol. Chem. 271: 18231—18236. PMID 8663478 DOI:10.1074/jbc.271.30.18231
  • Claret F.-X., Hibi M., Dhut S., Toda T., Karin M. (1996). A new group of conserved coactivators that increase the specificity of AP-1 transcription factors. Nature. 383: 453—457. PMID 8837781 DOI:10.1038/383453a0

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:6204 (англ.) . Процитовано 25 серпня 2017.
  4. (англ.) . Архів оригіналу за 1 вересня 2017. Процитовано 25 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

JUN angl Jun proto oncogene AP 1 transcription factor subunit bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 331 aminokislot a molekulyarna masa 35 676 JUNNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1A02 1JNM 1JUN 1S9K 1T2K 1FOSIdentifikatoriSimvoliJUN AP 1 AP1 c Jun Jun proto oncogene AP 1 transcription factor subunit p39 cJUNZovnishni ID OMIM 165160 MGI 96646 HomoloGene 1679 GeneCards JUNOntologiya genaMolekulyarna funkciya GO 0005097 GO 0005099 GO 0005100 GTPase activator activity GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific cAMP response element binding R SMAD binding HMG box domain binding transcription factor binding GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding transcription factor activity RNA polymerase II core promoter proximal region sequence specific binding enzyme binding chromatin binding GO 0001948 GO 0016582 protein binding double stranded DNA binding DNA binding sequence specific DNA binding GO 0001105 transcription coactivator activity identical protein binding transcription factor activity RNA polymerase II distal enhancer sequence specific binding RNA binding protein homodimerization activity protein heterodimerization activity ubiquitin protein ligase binding ubiquitin like protein ligase binding GO 0000975 transcription cis regulatory region bindingKlitinna komponenta gialoplazma transcription repressor complex klitinne yadro nuclear chromosome nukleoplazma transcription regulator complex transcription factor AP 1 complexBiologichnij proces GO 1904089 negative regulation of neuron apoptotic process negative regulation of DNA binding outflow tract morphogenesis transcription by RNA polymerase II navchennya monocyte differentiation response to organic substance leading edge cell differentiation Fc epsilon receptor signaling pathway positive regulation of neuron apoptotic process cellular response to hormone stimulus regulation of DNA binding transcription factor activity cirkadnij ritm Angiogenez positive regulation of ERK1 and ERK2 cascade Ras protein signal transduction transforming growth factor beta receptor signaling pathway negative regulation of cell population proliferation response to muscle stretch cellular response to calcium ion response to cytokine GO 0009373 regulation of transcription DNA templated SMAD protein signal transduction axon regeneration positive regulation of fibroblast proliferation response to mechanical stimulus positive regulation of epithelial cell migration positive regulation of DNA templated transcription initiation transcription DNA templated positive regulation of cell differentiation positive regulation of monocyte differentiation positive regulation of pri miRNA transcription by RNA polymerase II negative regulation of protein autophosphorylation membrane depolarization negative regulation of apoptotic process eyelid development in camera type eye microglial cell activation positive regulation of DNA replication response to lipopolysaccharide response to radiation response to cAMP GO 0045996 negative regulation of transcription DNA templated response to hydrogen peroxide positive regulation of smooth muscle cell proliferation positive regulation of endothelial cell proliferation GO 1904578 response to organic cyclic compound GO 0010260 starinnya lyudini regulation of cell cycle regulation of cell population proliferation positive regulation of cell population proliferation liver development negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress cellular response to potassium ion starvation GO 0006928 klitinnij proces release of cytochrome c from mitochondria GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity GO 0072353 cellular response to reactive oxygen species positive regulation of apoptotic process GO 0060469 GO 0009371 positive regulation of transcription DNA templated cellular response to cadmium ion GO 1901227 negative regulation of transcription by RNA polymerase II positive regulation of vascular associated smooth muscle cell proliferationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3725 16476Ensembl ENSG00000177606 ENSMUSG00000052684UniProt P05412 P05627RefSeq mRNK NM 002228NM 010591RefSeq bilok NP 002219NP 034721Lokus UCSC Hr 1 58 78 58 78 MbHr 4 94 94 94 94 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLK PHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCP KNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASV AGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQ PQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQ ERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do aktivatoriv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri LiteraturaHattori K Angel P le Beau M M Karin M 1988 Structure and chromosomal localization of the functional intronless human JUN protooncogene Proc Natl Acad Sci U S A 85 9148 9152 PMID 3194415 DOI 10 1073 pnas 85 23 9148 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Bannister A J Gottlieb T M Kouzarides T Jackson S P 1993 c Jun is phosphorylated by the DNA dependent protein kinase in vitro definition of the minimal kinase recognition motif Nucleic Acids Res 21 1289 1295 PMID 8464713 DOI 10 1093 nar 21 5 1289 Enslen H Tokumitsu H Stork P J Davis R J Soderling T R 1996 Regulation of mitogen activated protein kinases by a calcium calmodulin dependent protein kinase cascade Proc Natl Acad Sci U S A 93 10803 10808 PMID 8855261 DOI 10 1073 pnas 93 20 10803 Kirstein M Sanz L Moscat J Diaz Meco M T Saus J 1996 Cross talk between different enhancer elements during mitogenic induction of the human stromelysin 1 gene J Biol Chem 271 18231 18236 PMID 8663478 DOI 10 1074 jbc 271 30 18231 Claret F X Hibi M Dhut S Toda T Karin M 1996 A new group of conserved coactivators that increase the specificity of AP 1 transcription factors Nature 383 453 457 PMID 8837781 DOI 10 1038 383453a0PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6204 angl Procitovano 25 serpnya 2017 angl Arhiv originalu za 1 veresnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ