NFKBIA (англ. NFKB inhibitor alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми. Довжина поліпептидного ланцюга білка становить 317 амінокислот, а молекулярна маса — 35 609.
NFKBIA | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | NFKBIA, IKBA, MAD-3, NFKBI, NFKB inhibitor alpha, EDAID2 | ||||||||||||||||
Зовнішні ІД | OMIM: 164008 MGI: 104741 HomoloGene: 7863 GeneCards: NFKBIA | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
ectodermal dysplasia, anhidrotic, with T-cell immunodeficiency, autosomal dominant, Hypohidrotic ectodermal dysplasia with immune deficiency | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 14: 35.4 – 35.4 Mb | Хр. 12: 55.54 – 55.54 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MFQAAERPQE | WAMEGPRDGL | KKERLLDDRH | DSGLDSMKDE | EYEQMVKELQ | ||||
EIRLEPQEVP | RGSEPWKQQL | TEDGDSFLHL | AIIHEEKALT | MEVIRQVKGD | ||||
LAFLNFQNNL | QQTPLHLAVI | TNQPEIAEAL | LGAGCDPELR | DFRGNTPLHL | ||||
ACEQGCLASV | GVLTQSCTTP | HLHSILKATN | YNGHTCLHLA | SIHGYLGIVE | ||||
LLVSLGADVN | AQEPCNGRTA | LHLAVDLQNP | DLVSLLLKCG | ADVNRVTYQG | ||||
YSPYQLTWGR | PSTRIQQQLG | QLTLENLQML | PESEDEESYD | TESEFTEFTE | ||||
DELPYDDCVF | GGQRLTL |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як взаємодія хазяїн-вірус. Локалізований у цитоплазмі, ядрі.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Ganchi P.A., Sun S.C., Greene W.C., Ballard D.W. (1992). I kappa B/MAD-3 masks the nuclear localization signal of NF-kappa B p65 and requires the transactivation domain to inhibit NF-kappa B p65 DNA binding. Mol. Biol. Cell. 3: 1339—1352. PMID 1493333 DOI:10.1091/mbc.3.12.1339
- Scherer D.C., Brockman J.A., Chen Z., Maniatis T., Ballard D.W. (1995). Signal-induced degradation of IkappaB alpha requires site-specific ubiquitination. Proc. Natl. Acad. Sci. U.S.A. 92: 11259—11263. PMID 7479976 DOI:10.1073/pnas.92.24.11259
- McElhinny J.A., Trushin S.A., Bren G.D., Chester N., Paya C.V. (1996). Casein kinase II phosphorylates I kappa B alpha at S-283, S-289, S-293, and T-291 and is required for its degradation. Mol. Cell. Biol. 16: 899—906. PMID 8622692 DOI:10.1128/MCB.16.3.899
- Lin R., Beauparlant P., Makris C., Meloche S., Hiscott J. (1996). Phosphorylation of IkappaBalpha in the C-terminal PEST domain by casein kinase II affects intrinsic protein stability. Mol. Cell. Biol. 16: 1401—1409. PMID 8657113 DOI:10.1128/MCB.16.4.1401
- Sachdev S., Hoffmann A., Hannink M. (1998). Nuclear localization of IkappaB alpha is mediated by the second ankyrin repeat: the IkappaB alpha ankyrin repeats define a novel class of cis-acting nuclear import sequences. Mol. Cell. Biol. 18: 2524—2534. PMID 9566872 DOI:10.1128/MCB.18.5.2524
Примітки
- Захворювання, генетично пов'язані з NFKBIA переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:7797 (англ.) . Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
NFKBIA angl NFKB inhibitor alpha bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 14 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 317 aminokislot a molekulyarna masa 35 609 NFKBIANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1IKN 1NFIIdentifikatoriSimvoliNFKBIA IKBA MAD 3 NFKBI NFKB inhibitor alpha EDAID2Zovnishni ID OMIM 164008 MGI 104741 HomoloGene 7863 GeneCards NFKBIAPov yazani genetichni zahvoryuvannyaectodermal dysplasia anhidrotic with T cell immunodeficiency autosomal dominant Hypohidrotic ectodermal dysplasia with immune deficiency Ontologiya genaMolekulyarna funkciya transcription factor binding GO 0001948 GO 0016582 protein binding nuclear localization sequence binding identical protein binding enzyme binding ubiquitin protein ligase binding heat shock protein binding GO 0032403 protein containing complex binding NF kappaB bindingKlitinna komponenta citoplazma I kappaB NF kappaB complex klitinna membrana klitinne yadro gialoplazma vnutrishnoklitinnij GO 0009327 protein containing complex nukleoplazmaBiologichnij proces response to muscle stretch GO 0051247 GO 0051200 positive regulation of protein metabolic process response to exogenous dsRNA cytoplasmic sequestering of transcription factor negative regulation of DNA binding GO 1904579 cellular response to organic cyclic compound cytoplasmic sequestering of NF kappaB response to muramyl dipeptide negative regulation of apoptotic process cellular response to cytokine stimulus GO 0060469 GO 0009371 positive regulation of transcription DNA templated response to lipopolysaccharide cellular response to cold regulation of cell population proliferation positive regulation of cholesterol efflux nucleotide binding oligomerization domain containing 2 signaling pathway regulyaciya ekspresiyi geniv negative regulation of lipid storage GO 0022415 viral process negative regulation of NF kappaB transcription factor activity negative regulation of myeloid cell differentiation negative regulation of macrophage derived foam cell differentiation nucleotide binding oligomerization domain containing 1 signaling pathway lipopolysaccharide mediated signaling pathway negative regulation of Notch signaling pathway GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II GO 0097285 apoptoz liver regeneration toll like receptor 4 signaling pathway protein deubiquitination I kappaB kinase NF kappaB signaling tumor necrosis factor mediated signaling pathway positive regulation of inflammatory response cellular response to tumor necrosis factor interleukin 1 mediated signaling pathway regulation of NIK NF kappaB signaling protein import into nucleusDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4792 18035Ensembl ENSG00000100906 ENSMUSG00000021025UniProt P25963 Q9Z1E3RefSeq mRNK NM 020529NM 010907RefSeq bilok NP 065390NP 035037Lokus UCSC Hr 14 35 4 35 4 MbHr 12 55 54 55 54 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQ EIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGD LAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHL ACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVE LLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQG YSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE DELPYDDCVFGGQRLTL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak vzayemodiya hazyayin virus Lokalizovanij u citoplazmi yadri LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Ganchi P A Sun S C Greene W C Ballard D W 1992 I kappa B MAD 3 masks the nuclear localization signal of NF kappa B p65 and requires the transactivation domain to inhibit NF kappa B p65 DNA binding Mol Biol Cell 3 1339 1352 PMID 1493333 DOI 10 1091 mbc 3 12 1339 Scherer D C Brockman J A Chen Z Maniatis T Ballard D W 1995 Signal induced degradation of IkappaB alpha requires site specific ubiquitination Proc Natl Acad Sci U S A 92 11259 11263 PMID 7479976 DOI 10 1073 pnas 92 24 11259 McElhinny J A Trushin S A Bren G D Chester N Paya C V 1996 Casein kinase II phosphorylates I kappa B alpha at S 283 S 289 S 293 and T 291 and is required for its degradation Mol Cell Biol 16 899 906 PMID 8622692 DOI 10 1128 MCB 16 3 899 Lin R Beauparlant P Makris C Meloche S Hiscott J 1996 Phosphorylation of IkappaBalpha in the C terminal PEST domain by casein kinase II affects intrinsic protein stability Mol Cell Biol 16 1401 1409 PMID 8657113 DOI 10 1128 MCB 16 4 1401 Sachdev S Hoffmann A Hannink M 1998 Nuclear localization of IkappaB alpha is mediated by the second ankyrin repeat the IkappaB alpha ankyrin repeats define a novel class of cis acting nuclear import sequences Mol Cell Biol 18 2524 2534 PMID 9566872 DOI 10 1128 MCB 18 5 2524PrimitkiZahvoryuvannya genetichno pov yazani z NFKBIA pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7797 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 31 serpnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 14 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi