IL6R (англ. Interleukin 6 receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 468 амінокислот, а молекулярна маса — 51 548.
IL6R | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | IL6R, CD126, IL-6R-1, IL-6RA, IL6Q, IL6RA, IL6RQ, gp80, Interleukin-6 receptor, interleukin 6 receptor | ||||||||||||||||
Зовнішні ІД | OMIM: 147880 MGI: 105304 HomoloGene: 474 GeneCards: IL6R | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
ревматоїдний артрит, бронхіальна астма, seropositive rheumatoid arthritis | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 154.41 – 154.47 Mb | Хр. 3: 89.77 – 89.82 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MLAVGCALLA | ALLAAPGAAL | APRRCPAQEV | ARGVLTSLPG | DSVTLTCPGV | ||||
EPEDNATVHW | VLRKPAAGSH | PSRWAGMGRR | LLLRSVQLHD | SGNYSCYRAG | ||||
RPAGTVHLLV | DVPPEEPQLS | CFRKSPLSNV | VCEWGPRSTP | SLTTKAVLLV | ||||
RKFQNSPAED | FQEPCQYSQE | SQKFSCQLAV | PEGDSSFYIV | SMCVASSVGS | ||||
KFSKTQTFQG | CGILQPDPPA | NITVTAVARN | PRWLSVTWQD | PHSWNSSFYR | ||||
LRFELRYRAE | RSKTFTTWMV | KDLQHHCVIH | DAWSGLRHVV | QLRAQEEFGQ | ||||
GEWSEWSPEA | MGTPWTESRS | PPAENEVSTP | MQALTTNKDD | DNILFRDSAN | ||||
ATSLPVQDSS | SVPLPTFLVA | GGSLAFGTLL | CIAIVLRFKK | TWKLRALKEG | ||||
KTSMHPPYSL | GQLVPERPRP | TPVLVPLISP | PVSPSSLGSD | NTSSHNRPDA | ||||
RDPRSPYDIS | NTDYFFPR |
Кодований геном білок за функцією належить до рецепторів. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Novick D., Engelmann H., Wallach D., Rubinstein M. (1989). Soluble cytokine receptors are present in normal human urine. J. Exp. Med. 170: 1409—1414. PMID 2529343 DOI:10.1084/jem.170.4.1409
- Buk D.M., Renner O., Graeve L. (2005). Increased association with detergent-resistant membranes/lipid rafts of apically targeted mutants of the interleukin-6 receptor gp80. Eur. J. Cell Biol. 84: 819—831. PMID 16270750 DOI:10.1016/j.ejcb.2005.06.001
- Boulanger M.J., Chow D.-C., Brevnova E.E., Garcia K.C. (2003). Hexameric structure and assembly of the interleukin-6/IL-6 alpha-receptor/gp130 complex. Science. 300: 2101—2104. PMID 12829785 DOI:10.1126/science.1083901
- Martens A.S., Bode J.G., Heinrich P.C., Graeve L. (2000). The cytoplasmic domain of the interleukin-6 receptor gp80 mediates its basolateral sorting in polarized Madin-Darby canine kidney cells. J. Cell Sci. 113: 3593—3602. PMID 11017875
Примітки
- Захворювання, генетично пов'язані з IL6R переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 17 липня 2017. Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 25 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
IL6R angl Interleukin 6 receptor bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 468 aminokislot a molekulyarna masa 51 548 IL6RNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1N26 1P9M 2ARWIdentifikatoriSimvoliIL6R CD126 IL 6R 1 IL 6RA IL6Q IL6RA IL6RQ gp80 Interleukin 6 receptor interleukin 6 receptorZovnishni ID OMIM 147880 MGI 105304 HomoloGene 474 GeneCards IL6RPov yazani genetichni zahvoryuvannyarevmatoyidnij artrit bronhialna astma seropositive rheumatoid arthritis Ontologiya genaMolekulyarna funkciya ciliary neurotrophic factor receptor activity protein homodimerization activity interleukin 6 receptor binding GO 0001948 GO 0016582 protein binding GO 0016518 cytokine receptor activity enzyme binding ciliary neurotrophic factor binding interleukin 6 receptor activity interleukin 6 binding interleukin 12 receptor binding growth factor activity GO 0019974 cytokine binding interleukin 12 alpha subunit binding interleukin 23 receptor bindingKlitinna komponenta integral component of membrane membrana klitinna membrana extracellular region basolateral plasma membrane apical plasma membrane interleukin 6 receptor complex ciliary neurotrophic factor receptor complex mizhklitinnij prostir cell surface external side of plasma membrane receptor complex interleukin 12 complex interleukin 23 complexBiologichnij proces positive regulation of activation of Janus kinase activity response to cytokine hepatic immune response extrinsic apoptotic signaling pathway monocyte chemotaxis ciliary neurotrophic factor mediated signaling pathway positive regulation of leukocyte chemotaxis negative regulation of interleukin 8 production positive regulation of osteoblast differentiation GO 0051636 defense response to Gram negative bacterium acute phase response positive regulation of NF kappaB transcription factor activity positive regulation of cell population proliferation positive regulation of interleukin 6 production positive regulation of peptidyl tyrosine phosphorylation positive regulation of chemokine production neutrophil mediated immunity negative regulation of collagen biosynthetic process endocrine pancreas development positive regulation of MAPK cascade positive regulation of smooth muscle cell proliferation GO 0051637 defense response to Gram positive bacterium positive regulation of tyrosine phosphorylation of STAT protein cytokine mediated signaling pathway interleukin 6 mediated signaling pathway positive regulation of T helper 1 type immune response regulation of signaling receptor activity positive regulation of interferon gamma production positive regulation of natural killer cell activation positive regulation of activated T cell proliferation positive regulation of lymphocyte proliferation positive regulation of NK T cell activation positive regulation of glomerular mesangial cell proliferationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3570 16194Ensembl ENSG00000160712 ENSMUSG00000027947UniProt P08887 P22272RefSeq mRNK NM 000565 NM 001206866 NM 181359NM 010559 NM 001310676RefSeq bilok NP 000556 NP 001193795 NP 852004 NP 001369698 NP 001369699NP 001369700 NP 001369701 NP 001369702 NP 001369703NP 001297605 NP 034689Lokus UCSC Hr 1 154 41 154 47 MbHr 3 89 77 89 82 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGV EPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAG RPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGS KFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYR LRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN ATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEG KTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA RDPRSPYDISNTDYFFPR A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do receptoriv Zadiyanij u takomu biologichnomu procesi yak polimorfizm Lokalizovanij u klitinnij membrani membrani Takozh sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Novick D Engelmann H Wallach D Rubinstein M 1989 Soluble cytokine receptors are present in normal human urine J Exp Med 170 1409 1414 PMID 2529343 DOI 10 1084 jem 170 4 1409 Buk D M Renner O Graeve L 2005 Increased association with detergent resistant membranes lipid rafts of apically targeted mutants of the interleukin 6 receptor gp80 Eur J Cell Biol 84 819 831 PMID 16270750 DOI 10 1016 j ejcb 2005 06 001 Boulanger M J Chow D C Brevnova E E Garcia K C 2003 Hexameric structure and assembly of the interleukin 6 IL 6 alpha receptor gp130 complex Science 300 2101 2104 PMID 12829785 DOI 10 1126 science 1083901 Martens A S Bode J G Heinrich P C Graeve L 2000 The cytoplasmic domain of the interleukin 6 receptor gp80 mediates its basolateral sorting in polarized Madin Darby canine kidney cells J Cell Sci 113 3593 3602 PMID 11017875PrimitkiZahvoryuvannya genetichno pov yazani z IL6R pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 17 lipnya 2017 Procitovano 25 serpnya 2017 angl Arhiv originalu za 25 serpnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi