Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

IL23A англ Interleukin 23 subunit alpha білок який кодується однойменним геном розташованим у людей на 12 й хромосомі До

IL23A

IL23A

IL23A (англ. Interleukin 23 subunit alpha) – білок, який кодується однойменним геном, розташованим у людей на 12-й хромосомі. Довжина поліпептидного ланцюга білка становить 189 амінокислот, а молекулярна маса — 20 730.

IL23A
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IL23A, IL-23, IL-23A, IL23P19, P19, SGRF, Interleukin 23, interleukin 23 subunit alpha
Зовнішні ІД OMIM: 605580 MGI: 1932410 HomoloGene: 12832 GeneCards: IL23A
Реагує на сполуку
tildrakizumab
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
51561
83430
Ensembl
ENSG00000110944
ENSMUSG00000025383
UniProt
Q9NPF7
Q9EQ14
RefSeq (мРНК)
NM_016584
NM_031252
RefSeq (білок)
NP_057668
NP_112542
Локус (UCSC) Хр. 12: 56.33 – 56.34 Mb Хр. 10: 128.13 – 128.13 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPL
VGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFY
EKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSL
SPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, запальна відповідь, ремоделювання тканини, противірусний захист. Секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Pirhonen J., Matikainen S., Julkunen I. (2002). Regulation of virus-induced IL-12 and IL-23 expression in human macrophages. J. Immunol. 169: 5673—5678. PMID 12421946 DOI:10.4049/jimmunol.169.10.5673
  • Vanden Eijnden S., Goriely S., De Wit D., Goldman M., Willems F. (2006). Preferential production of the IL-12(p40)/IL-23(p19) heterodimer by dendritic cells from human newborns. Eur. J. Immunol. 36: 21—26. PMID 16342235 DOI:10.1002/eji.200535467
  • Piskin G., Sylva-Steenland R.M.R., Bos J.D., Teunissen M.B.M. (2006). In vitro and in situ expression of IL-23 by keratinocytes in healthy skin and psoriasis lesions: enhanced expression in psoriatic skin. J. Immunol. 176: 1908—1915. PMID 16424222 DOI:10.4049/jimmunol.176.3.1908
  • Vaknin-Dembinsky A., Balashov K., Weiner H.L. (2006). IL-23 is increased in dendritic cells in multiple sclerosis and down-regulation of IL-23 by antisense oligos increases dendritic cell IL-10 production. J. Immunol. 176: 7768—7774. PMID 16751425 DOI:10.4049/jimmunol.176.12.7768
  • Lupardus P.J., Garcia K.C. (2008). The structure of interleukin-23 reveals the molecular basis of p40 subunit sharing with interleukin-12. J. Mol. Biol. 382: 931—941. PMID 18680750 DOI:10.1016/j.jmb.2008.07.051

Примітки

  1. Сполуки, які фізично взаємодіють з IL23A переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:15488 (англ.) . Процитовано 19 вересня 2017.
  5. (англ.) . Архів оригіналу за 2 жовтня 2017. Процитовано 19 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

IL23A angl Interleukin 23 subunit alpha bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na 12 j hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 189 aminokislot a molekulyarna masa 20 730 IL23ANayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB3D85 3D87 3DUH 3QWR 4GRW 4OE8 4OG9IdentifikatoriSimvoliIL23A IL 23 IL 23A IL23P19 P19 SGRF Interleukin 23 interleukin 23 subunit alphaZovnishni ID OMIM 605580 MGI 1932410 HomoloGene 12832 GeneCards IL23AReaguye na spolukutildrakizumabOntologiya genaMolekulyarna funkciya cytokine activity interleukin 23 receptor binding GO 0001948 GO 0016582 protein bindingKlitinna komponenta interleukin 23 complex extracellular region mizhklitinnij prostir endoplasmic reticulum lumenBiologichnij proces negative regulation of interleukin 10 production positive regulation of inflammatory response positive regulation of interleukin 12 production positive regulation of interleukin 10 production proces imunnoyi sistemi positive regulation of T cell mediated cytotoxicity positive regulation of interferon gamma production positive regulation of natural killer cell activation positive regulation of osteoclast differentiation positive regulation of T helper 17 cell lineage commitment positive regulation of NK T cell activation T cell proliferation positive regulation of natural killer cell proliferation positive regulation of NK T cell proliferation positive regulation of T helper 17 type immune response defense response to virus positive regulation of tissue remodeling positive regulation of T helper 1 type immune response positive regulation of granulocyte macrophage colony stimulating factor production GO 0051636 defense response to Gram negative bacterium positive regulation of T cell proliferation GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid positive regulation of memory T cell differentiation positive regulation of neutrophil chemotaxis positive regulation of tumor necrosis factor production positive regulation of interleukin 17 production vrodzhenij imunitet inflammatory response tissue remodeling GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of activated T cell proliferation positive regulation of defense response to virus by host positive regulation of activation of Janus kinase activity regulation of tyrosine phosphorylation of STAT protein positive regulation of tyrosine phosphorylation of STAT protein regulation of signaling receptor activity cytokine mediated signaling pathway interleukin 23 mediated signaling pathway positive regulation of NIK NF kappaB signalingDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez51561 83430Ensembl ENSG00000110944 ENSMUSG00000025383UniProt Q9NPF7 Q9EQ14RefSeq mRNK NM 016584NM 031252RefSeq bilok NP 057668NP 112542Lokus UCSC Hr 12 56 33 56 34 MbHr 10 128 13 128 13 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do citokiniv Zadiyanij u takih biologichnih procesah yak imunitet vrodzhenij imunitet zapalna vidpovid remodelyuvannya tkanini protivirusnij zahist Sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Pirhonen J Matikainen S Julkunen I 2002 Regulation of virus induced IL 12 and IL 23 expression in human macrophages J Immunol 169 5673 5678 PMID 12421946 DOI 10 4049 jimmunol 169 10 5673 Vanden Eijnden S Goriely S De Wit D Goldman M Willems F 2006 Preferential production of the IL 12 p40 IL 23 p19 heterodimer by dendritic cells from human newborns Eur J Immunol 36 21 26 PMID 16342235 DOI 10 1002 eji 200535467 Piskin G Sylva Steenland R M R Bos J D Teunissen M B M 2006 In vitro and in situ expression of IL 23 by keratinocytes in healthy skin and psoriasis lesions enhanced expression in psoriatic skin J Immunol 176 1908 1915 PMID 16424222 DOI 10 4049 jimmunol 176 3 1908 Vaknin Dembinsky A Balashov K Weiner H L 2006 IL 23 is increased in dendritic cells in multiple sclerosis and down regulation of IL 23 by antisense oligos increases dendritic cell IL 10 production J Immunol 176 7768 7774 PMID 16751425 DOI 10 4049 jimmunol 176 12 7768 Lupardus P J Garcia K C 2008 The structure of interleukin 23 reveals the molecular basis of p40 subunit sharing with interleukin 12 J Mol Biol 382 931 941 PMID 18680750 DOI 10 1016 j jmb 2008 07 051PrimitkiSpoluki yaki fizichno vzayemodiyut z IL23A pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 15488 angl Procitovano 19 veresnya 2017 angl Arhiv originalu za 2 zhovtnya 2017 Procitovano 19 veresnya 2017 Div takozhHromosoma 12Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ