Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

IL1R1 англ Interleukin 1 receptor type 1 білок який кодується однойменним геном розташованим у людей на короткому плечі

IL1R1

IL1R1

IL1R1 (англ. Interleukin 1 receptor type 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 569 амінокислот, а молекулярна маса — 65 402.

IL1R1
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IL1R1, CD121A, D2S1473, IL-1R-alpha, IL1R, IL1RA, P80, Interleukin 1 receptor, type I, interleukin 1 receptor type 1
Зовнішні ІД OMIM: 147810 MGI: 96545 HomoloGene: 677 GeneCards: IL1R1
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
3554
16177
Ensembl
ENSG00000115594
ENSMUSG00000026072
UniProt
P14778
P13504
RefSeq (мРНК)
NM_001123382
NM_008362
RefSeq (білок)
NP_001116854
NP_032388
Локус (UCSC) Хр. 2: 102.06 – 102.18 Mb Хр. 1: 40.23 – 40.32 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNE
HKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRN
SSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKN
ENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASY
TYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNV
TGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIV
CSVFIYKIFKIDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGST
SDCDIFVFKVLPEVLEKQCGYKLFIYGRDDYVGEDIVEVINENVKKSRRL
IIILVRETSGFSWLGGSSEEQIAMYNALVQDGIKVVLLELEKIQDYEKMP
ESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPVQRRSPSSKHQ
LLSPATKEKLQREAHVPLG

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.

Література

  • Chua A.O., Gubler U. (1989). Sequence of the cDNA for the human fibroblast type interleukin-1 receptor. Nucleic Acids Res. 17: 10114—10114. PMID 2532321 DOI:10.1093/nar/17.23.10114
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Svenson M., Hansen M.B., Heegaard P., Abell K., Bendtzen K. (1993). Specific binding of interleukin 1 (IL-1) beta and IL-1 receptor antagonist (IL-1ra) to human serum. High-affinity binding of IL-1ra to soluble IL-1 receptor type I. Cytokine. 5: 427—435. PMID 8142597 DOI:10.1016/1043-4666(93)90032-Z
  • Huang J., Gao X., Li S., Cao Z. (1997). Recruitment of IRAK to the interleukin 1 receptor complex requires interleukin 1 receptor accessory protein. Proc. Natl. Acad. Sci. U.S.A. 94: 12829—12832. PMID 9371760 DOI:10.1073/pnas.94.24.12829
  • Vigers G.P.A., Anderson L.J., Caffes P., Brandhuber B.J. (1997). Crystal structure of the type-I interleukin-1 receptor complexed with interleukin-1beta. Nature. 386: 190—194. PMID 9062193 DOI:10.1038/386190a0
  • Vigers G.P.A., Dripps D.J., Edwards C.K. III, Brandhuber B.J. (2000). X-ray crystal structure of a small antagonist peptide bound to interleukin-1 receptor type 1. J. Biol. Chem. 275: 36927—36933. PMID 10903327 DOI:10.1074/jbc.M006071200

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 3 вересня 2017. Процитовано 28 серпня 2017.
  4. (англ.) . Архів оригіналу за 11 вересня 2017. Процитовано 28 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

IL1R1 angl Interleukin 1 receptor type 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 569 aminokislot a molekulyarna masa 65 402 IL1R1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1G0Y 1IRA 1ITB 4DEP 4GAFIdentifikatoriSimvoliIL1R1 CD121A D2S1473 IL 1R alpha IL1R IL1RA P80 Interleukin 1 receptor type I interleukin 1 receptor type 1Zovnishni ID OMIM 147810 MGI 96545 HomoloGene 677 GeneCards IL1R1Ontologiya genaMolekulyarna funkciya interleukin 1 type I activating receptor activity signal transducer activity platelet derived growth factor receptor binding protease binding GO 0001948 GO 0016582 protein binding transmembrane signaling receptor activity interleukin 1 receptor activity interleukin 1 bindingKlitinna komponenta integral component of membrane membrana klitinna membrana integral component of plasma membrane extracellular region cell surface external side of plasma membraneBiologichnij proces cell surface receptor signaling pathway GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid regulation of inflammatory response GO 0072468 signalna transdukciya positive regulation of interleukin 1 mediated signaling pathway positive regulation of neutrophil extravasation response to interleukin 1 cytokine mediated signaling pathway interleukin 1 mediated signaling pathway positive regulation of interferon gamma production positive regulation of T helper 1 cell cytokine production inflammatory responseDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3554 16177Ensembl ENSG00000115594 ENSMUSG00000026072UniProt P14778 P13504RefSeq mRNK NM 000877 NM 001288706 NM 001320978 NM 001320980 NM 001320981NM 001320982 NM 001320983 NM 001320984 NM 001320985 NM 001320986NM 001123382 NM 008362RefSeq bilok NP 000868 NP 001275635 NP 001307907 NP 001307909 NP 001307910NP 001307911 NP 001307912 NP 001307913 NP 001307914 NP 001307915NP 001116854 NP 032388Lokus UCSC Hr 2 102 06 102 18 MbHr 1 40 23 40 32 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNE HKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRN SSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKN ENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASY TYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNV TGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIV CSVFIYKIFKIDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGST SDCDIFVFKVLPEVLEKQCGYKLFIYGRDDYVGEDIVEVINENVKKSRRL IIILVRETSGFSWLGGSSEEQIAMYNALVQDGIKVVLLELEKIQDYEKMP ESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPVQRRSPSSKHQ LLSPATKEKLQREAHVPLG A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak polimorfizm Lokalizovanij u klitinnij membrani membrani Takozh sekretovanij nazovni LiteraturaChua A O Gubler U 1989 Sequence of the cDNA for the human fibroblast type interleukin 1 receptor Nucleic Acids Res 17 10114 10114 PMID 2532321 DOI 10 1093 nar 17 23 10114 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Svenson M Hansen M B Heegaard P Abell K Bendtzen K 1993 Specific binding of interleukin 1 IL 1 beta and IL 1 receptor antagonist IL 1ra to human serum High affinity binding of IL 1ra to soluble IL 1 receptor type I Cytokine 5 427 435 PMID 8142597 DOI 10 1016 1043 4666 93 90032 Z Huang J Gao X Li S Cao Z 1997 Recruitment of IRAK to the interleukin 1 receptor complex requires interleukin 1 receptor accessory protein Proc Natl Acad Sci U S A 94 12829 12832 PMID 9371760 DOI 10 1073 pnas 94 24 12829 Vigers G P A Anderson L J Caffes P Brandhuber B J 1997 Crystal structure of the type I interleukin 1 receptor complexed with interleukin 1beta Nature 386 190 194 PMID 9062193 DOI 10 1038 386190a0 Vigers G P A Dripps D J Edwards C K III Brandhuber B J 2000 X ray crystal structure of a small antagonist peptide bound to interleukin 1 receptor type 1 J Biol Chem 275 36927 36933 PMID 10903327 DOI 10 1074 jbc M006071200PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 3 veresnya 2017 Procitovano 28 serpnya 2017 angl Arhiv originalu za 11 veresnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ