IL1B (англ. Interleukin 1 beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 269 амінокислот, а молекулярна маса — 30 748.
IL1B | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | IL1B, IL-1, IL1-BETA, IL1F2, interleukin 1 beta, IL1beta | ||||||||||||||||
Зовнішні ІД | OMIM: 147720 MGI: 96543 HomoloGene: 481 GeneCards: IL1B | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 112.83 – 112.84 Mb | Хр. 2: 129.21 – 129.21 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAEVPELASE | MMAYYSGNED | DLFFEADGPK | QMKCSFQDLD | LCPLDGGIQL | ||||
RISDHHYSKG | FRQAASVVVA | MDKLRKMLVP | CPQTFQENDL | STFFPFIFEE | ||||
EPIFFDTWDN | EAYVHDAPVR | SLNCTLRDSQ | QKSLVMSGPY | ELKALHLQGQ | ||||
DMEQQVVFSM | SFVQGEESND | KIPVALGLKE | KNLYLSCVLK | DDKPTLQLES | ||||
VDPKNYPKKK | MEKRFVFNKI | EINNKLEFES | AQFPNWYIST | SQAENMPVFL | ||||
GGTKGGQDIT | DFTMQFVSS |
Кодований геном білок за функціями належить до цитокінів, мітогенів. Задіяний у таких біологічних процесах як запальна відповідь, поліморфізм. Локалізований у цитоплазмі, лізосомі. Також секретований назовні.
Література
- Clark B.D., Collins K.L., Gandy M.S., Webb A.C., Auron P.E. (1986). Genomic sequence for human prointerleukin 1 beta: possible evolution from a reverse transcribed prointerleukin 1 alpha gene. Nucleic Acids Res. 14: 7897—7914. PMID 3490654 DOI:10.1093/nar/14.20.7897
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Mizutani H., Schechter N., Lazarus G., Black R.A., Kupper T.S. (1991). Rapid and specific conversion of precursor interleukin 1 beta (IL-1 beta) to an active IL-1 species by human mast cell chymase. J. Exp. Med. 174: 821—825. PMID 1919436 DOI:10.1084/jem.174.4.821
- Nanduri V.B., Hulmes J.D., Pan Y.C., Kilian P.L., Stern A.S. (1991). The role of arginine residues in interleukin 1 receptor binding. Biochim. Biophys. Acta. 1118: 25—35. PMID 1837236 DOI:10.1016/0167-4838(91)90437-5
- Piccioli P., Rubartelli A. (2013). The secretion of IL-1beta and options for release. Semin. Immunol. 25: 425—429. PMID 24201029 DOI:10.1016/j.smim.2013.10.007
- Priestle J.P., Schar H.-P., Gruetter M.G. (1989). Crystallographic refinement of interleukin 1 beta at 2.0-A resolution. Proc. Natl. Acad. Sci. U.S.A. 86: 9667—9671. PMID 2602367 DOI:10.1073/pnas.86.24.9667
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:5992 (англ.) . Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 20 серпня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
IL1B angl Interleukin 1 beta bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 269 aminokislot a molekulyarna masa 30 748 IL1BNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1HIB 1I1B 1IOB 1ITB 1L2H 1S0L 1T4Q 1TOO 1TP0 1TWE 1TWM 21BI 2I1B 2KH2 2NVH 31BI 3O4O 3POK 41BI 4DEP 4G6J 4G6M 4GAI 4I1B 5I1B 6I1B 7I1B 9ILB 4GAF 5BVPIdentifikatoriSimvoliIL1B IL 1 IL1 BETA IL1F2 interleukin 1 beta IL1betaZovnishni ID OMIM 147720 MGI 96543 HomoloGene 481 GeneCards IL1BOntologiya genaMolekulyarna funkciya protein domain specific binding interleukin 1 receptor binding cytokine activity integrin binding GO 0001948 GO 0016582 protein bindingKlitinna komponenta citoplazma gialoplazma extracellular region lizosoma ekzosoma secretory granule vezikula mizhklitinnij prostirBiologichnij proces positive regulation of protein phosphorylation smooth muscle adaptation positive regulation of calcidiol 1 monooxygenase activity GO 1903105 negative regulation of insulin receptor signaling pathway cellular response to mechanical stimulus positive regulation of interleukin 8 production positive regulation of mitotic nuclear division response to carbohydrate embryo implantation regulation of I kappaB kinase NF kappaB signaling negative regulation of cell population proliferation GO 0097285 apoptoz cellular response to organic substance positive regulation of phagocytosis regulation of insulin secretion neutrophil chemotaxis GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of protein export from nucleus positive regulation of prostaglandin secretion positive regulation of myosin light chain kinase activity negative regulation of MAP kinase activity positive regulation of T cell proliferation positive regulation of interleukin 6 production inflammatory response negative regulation of lipid metabolic process sequestering of triglyceride hyaluronan biosynthetic process positive regulation of heterotypic cell cell adhesion positive regulation of lipid catabolic process GO 1904579 cellular response to organic cyclic compound positive regulation of fever generation positive regulation of DNA binding transcription factor activity positive regulation of angiogenesis response to lipopolysaccharide positive regulation of NF kappaB transcription factor activity positive regulation of granulocyte macrophage colony stimulating factor production GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid ectopic germ cell programmed cell death leukocyte migration lipopolysaccharide mediated signaling pathway positive regulation of vascular endothelial growth factor receptor signaling pathway positive regulation of cell adhesion molecule production response to ATP monocyte aggregation protein kinase B signaling positive regulation of nitric oxide biosynthetic process cell cell signaling positive regulation of monocyte chemotactic protein 1 production regulation of nitric oxide synthase activity positive regulation of membrane protein ectodomain proteolysis positive regulation of interferon gamma production MAPK cascade positive regulation of histone acetylation GO 1901313 positive regulation of gene expression negative regulation of glucose transmembrane transport interleukin 1 beta production positive regulation of T cell mediated immunity extrinsic apoptotic signaling pathway in absence of ligand positive regulation of I kappaB kinase NF kappaB signaling positive regulation of vascular endothelial growth factor production negative regulation of extrinsic apoptotic signaling pathway in absence of ligand negative regulation of lipid catabolic process negative regulation of adiponectin secretion regulation of establishment of endothelial barrier positive regulation of cell division GO 0072468 signalna transdukciya GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II cytokine mediated signaling pathway regulation of defense response to virus by host fever generation positive regulation of JNK cascade positive regulation of cell population proliferation regulation of signaling receptor activity positive regulation of epithelial to mesenchymal transition positive regulation of cell migration interleukin 6 production astrocyte activation regulation of neurogenesis negative regulation of neurogenesis negative regulation of synaptic transmission positive regulation of glial cell proliferation regulation of ERK1 and ERK2 cascade interleukin 1 mediated signaling pathway cellular response to lipopolysaccharide positive regulation of neuroinflammatory response positive regulation of p38MAPK cascade positive regulation of NIK NF kappaB signaling positive regulation of T helper 1 cell cytokine production positive regulation of prostaglandin biosynthetic process positive regulation of complement activation positive regulation of inflammatory response response to interleukin 1 positive regulation of RNA biosynthetic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3553 16176Ensembl ENSG00000125538 ENSMUSG00000027398UniProt P01584 P10749RefSeq mRNK NM 000576NM 008361RefSeq bilok NP 000567NP 032387Lokus UCSC Hr 2 112 83 112 84 MbHr 2 129 21 129 21 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL RISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEE EPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQ DMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLES VDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFL GGTKGGQDITDFTMQFVSS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do citokiniv mitogeniv Zadiyanij u takih biologichnih procesah yak zapalna vidpovid polimorfizm Lokalizovanij u citoplazmi lizosomi Takozh sekretovanij nazovni LiteraturaClark B D Collins K L Gandy M S Webb A C Auron P E 1986 Genomic sequence for human prointerleukin 1 beta possible evolution from a reverse transcribed prointerleukin 1 alpha gene Nucleic Acids Res 14 7897 7914 PMID 3490654 DOI 10 1093 nar 14 20 7897 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Mizutani H Schechter N Lazarus G Black R A Kupper T S 1991 Rapid and specific conversion of precursor interleukin 1 beta IL 1 beta to an active IL 1 species by human mast cell chymase J Exp Med 174 821 825 PMID 1919436 DOI 10 1084 jem 174 4 821 Nanduri V B Hulmes J D Pan Y C Kilian P L Stern A S 1991 The role of arginine residues in interleukin 1 receptor binding Biochim Biophys Acta 1118 25 35 PMID 1837236 DOI 10 1016 0167 4838 91 90437 5 Piccioli P Rubartelli A 2013 The secretion of IL 1beta and options for release Semin Immunol 25 425 429 PMID 24201029 DOI 10 1016 j smim 2013 10 007 Priestle J P Schar H P Gruetter M G 1989 Crystallographic refinement of interleukin 1 beta at 2 0 A resolution Proc Natl Acad Sci U S A 86 9667 9671 PMID 2602367 DOI 10 1073 pnas 86 24 9667PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 5992 angl Procitovano 28 serpnya 2017 angl Arhiv originalu za 20 serpnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi