IGFBP2 (англ. Insulin like growth factor binding protein 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 325 амінокислот, а молекулярна маса — 34 814.
IGFBP2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | IGFBP2, IBP2, IGF-BP53, insulin like growth factor binding protein 2 | ||||||||||||||||
Зовнішні ІД | OMIM: 146731 MGI: 96437 HomoloGene: 499 GeneCards: IGFBP2 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 216.63 – 216.66 Mb | Хр. 1: 72.86 – 72.89 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MLPRVGCPAL | PLPPPPLLPL | LLLLLGASGG | GGGARAEVLF | RCPPCTPERL | ||||
AACGPPPVAP | PAAVAAVAGG | ARMPCAELVR | EPGCGCCSVC | ARLEGEACGV | ||||
YTPRCGQGLR | CYPHPGSELP | LQALVMGEGT | CEKRRDAEYG | ASPEQVADNG | ||||
DDHSEGGLVE | NHVDSTMNML | GGGGSAGRKP | LKSGMKELAV | FREKVTEQHR | ||||
QMGKGGKHHL | GLEEPKKLRP | PPARTPCQQE | LDQVLERIST | MRLPDERGPL | ||||
EHLYSLHIPN | CDKHGLYNLK | QCKMSLNGQR | GECWCVNPNT | GKLIQGAPTI | ||||
RGDPECHLFY | NEQQEARGVH | TQRMQ |
Задіяний у таких біологічних процесах як регуляція росту, поліморфізм. Секретований назовні.
Література
- Binkert C., Margot J.B., Landwehr J., Heinrich G., Schwander J. (1992). Structure of the human insulin-like growth factor binding protein-2 gene. Mol. Endocrinol. 6: 826—836. PMID 1376411 doi:10.1210/mend.6.5.1376411
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 doi:10.1101/gr.2596504
- Zhou J., Li W., Kamei H., Duan C. (2008). Duplication of the IGFBP-2 gene in teleost fish: protein structure and functionality conservation and gene expression divergence. PLoS ONE. 3: E3926—E3926. PMID 19081843 doi:10.1371/journal.pone.0003926
- Binkert C., Landwehr J., Mary J.L., Schwander J., Heinrich G. (1989). Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2). EMBO J. 8: 2497—2502. PMID 2479552
- Roghani M., Segovia B., Whitechurch O., Binoux M. (1991). Purification from human cerebrospinal fluid of insulin-like growth factor binding proteins (IGFBPs). Isolation of IGFBP-2, an altered form of IGFBP-3 and a new IGFBP species. Growth Regul. 1: 125—130. PMID 1726837
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:5471 (англ.) . Архів оригіналу за 26 травня 2017. Процитовано 28 серпня 2017. [Архівовано 2017-05-26 у Wayback Machine.]
- UniProt, P18065 (англ.) . Архів оригіналу за 24 липня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до . |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
IGFBP2 angl Insulin like growth factor binding protein 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 325 aminokislot a molekulyarna masa 34 814 4 IGFBP2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2H7TIdentifikatoriSimvoliIGFBP2 IBP2 IGF BP53 insulin like growth factor binding protein 2Zovnishni ID OMIM 146731 MGI 96437 HomoloGene 499 GeneCards IGFBP2Ontologiya genaMolekulyarna funkciya insulin like growth factor binding growth factor binding insulin like growth factor I binding insulin like growth factor II binding GO 0001948 GO 0016582 protein binding signaling receptor bindingKlitinna komponenta extracellular region apical plasma membrane ekzosoma GO 0016023 cytoplasmic vesicle mizhklitinnij prostirBiologichnij proces response to estradiol response to retinoic acid response to nutrient zhinocha vagitnist response to steroid hormone response to mechanical stimulus GO 0010260 starinnya lyudini response to glucocorticoid response to lithium ion response to estrogen regulation of insulin like growth factor receptor signaling pathway cellular response to hormone stimulus regulation of cell growth regulation of growth negative regulation of canonical Wnt signaling pathway GO 0072468 signalna transdukciya positive regulation of activated T cell proliferationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3485 16008Ensembl ENSG00000115457 ENSMUSG00000039323UniProt P18065 P47877RefSeq mRNK NM 001313990 NM 001313992 NM 001313993 NM 000597NM 008342 NM 001310659RefSeq bilok NP 000588 NP 001300919 NP 001300921 NP 001300922NP 001297588 NP 032368Lokus UCSC Hr 2 216 63 216 66 MbHr 1 72 86 72 89 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERL AACGPPPVAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGV YTPRCGQGLRCYPHPGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNG DDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQHR QMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPL EHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTI RGDPECHLFYNEQQEARGVHTQRMQ A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak regulyaciya rostu polimorfizm Sekretovanij nazovni Literaturared Binkert C Margot J B Landwehr J Heinrich G Schwander J 1992 Structure of the human insulin like growth factor binding protein 2 gene Mol Endocrinol 6 826 836 PMID 1376411 doi 10 1210 mend 6 5 1376411 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 doi 10 1101 gr 2596504 Zhou J Li W Kamei H Duan C 2008 Duplication of the IGFBP 2 gene in teleost fish protein structure and functionality conservation and gene expression divergence PLoS ONE 3 E3926 E3926 PMID 19081843 doi 10 1371 journal pone 0003926 Binkert C Landwehr J Mary J L Schwander J Heinrich G 1989 Cloning sequence analysis and expression of a cDNA encoding a novel insulin like growth factor binding protein IGFBP 2 EMBO J 8 2497 2502 PMID 2479552 Roghani M Segovia B Whitechurch O Binoux M 1991 Purification from human cerebrospinal fluid of insulin like growth factor binding proteins IGFBPs Isolation of IGFBP 2 an altered form of IGFBP 3 and a new IGFBP species Growth Regul 1 125 130 PMID 1726837Primitkired Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 5471 angl Arhiv originalu za 26 travnya 2017 Procitovano 28 serpnya 2017 Arhivovano 2017 05 26 u Wayback Machine UniProt P18065 angl Arhiv originalu za 24 lipnya 2017 Procitovano 28 serpnya 2017 Div takozhred Hromosoma 2 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij Otrimano z https uk wikipedia org w index php title IGFBP2 amp oldid 44004066