ICAM1 (англ. Intercellular adhesion molecule 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 532 амінокислот, а молекулярна маса — 57 825.
ICAM1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | ICAM1, BB2, CD54, P3.58, intercellular adhesion molecule 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 147840 MGI: 96392 HomoloGene: 168 GeneCards: ICAM1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 19: 10.27 – 10.29 Mb | Хр. 9: 20.93 – 20.94 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAPSSPRPAL | PALLVLLGAL | FPGPGNAQTS | VSPSKVILPR | GGSVLVTCST | ||||
SCDQPKLLGI | ETPLPKKELL | LPGNNRKVYE | LSNVQEDSQP | MCYSNCPDGQ | ||||
STAKTFLTVY | WTPERVELAP | LPSWQPVGKN | LTLRCQVEGG | APRANLTVVL | ||||
LRGEKELKRE | PAVGEPAEVT | TTVLVRRDHH | GANFSCRTEL | DLRPQGLELF | ||||
ENTSAPYQLQ | TFVLPATPPQ | LVSPRVLEVD | TQGTVVCSLD | GLFPVSEAQV | ||||
HLALGDQRLN | PTVTYGNDSF | SAKASVSVTA | EDEGTQRLTC | AVILGNQSQE | ||||
TLQTVTIYSF | PAPNVILTKP | EVSEGTEVTV | KCEAHPRAKV | TLNGVPAQPL | ||||
GPRAQLLLKA | TPEDNGRSFS | CSATLEVAGQ | LIHKNQTREL | RVLYGPRLDE | ||||
RDCPGNWTWP | ENSQQTPMCQ | AWGNPLPELK | CLKDGTFPLP | IGESVTVTRD | ||||
LEGTYLCRAR | STQGEVTRKV | TVNVLSPRYE | IVIITVVAAA | VIMGTAGLST | ||||
YLYNRQRKIK | KYRLQQAQKG | TPMKPNTQAT | PP |
Кодований геном білок за функціями належить до рецепторів клітини-хазяїна для входу вірусу, рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинна адгезія, взаємодія хазяїн-вірус. Локалізований у мембрані.
Література
- Simmons D., Makgoba M.W., Seed B. (1988). ICAM, an adhesion ligand of LFA-1, is homologous to the neural cell adhesion molecule NCAM. Nature. 331: 624—627. PMID 3340213 DOI:10.1038/331624a0
- Staunton D.E., Marlin S.D., Stratowa C., Dustin M.L., Springer T.A. (1988). Primary structure of ICAM-1 demonstrates interaction between members of the immunoglobulin and integrin supergene families. Cell. 52: 925—933. PMID 3349522 DOI:10.1016/0092-8674(88)90434-5
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Walter N.A.R., Stebbing J., Messier W. (2005). The potential significance of adaptive evolution and dimerization in chimpanzee intercellular cell adhesion molecules (ICAMs). J. Theor. Biol. 232: 339—346. PMID 15572059 DOI:10.1016/j.jtbi.2004.08.024
- Coscoy L., Ganem D. (2001). A viral protein that selectively downregulates ICAM-1 and B7-2 and modulates T cell costimulation. J. Clin. Invest. 107: 1599—1606. PMID 11413168 DOI:10.1172/JCI12432
- Hoer S., Smith L., Lehner P.J. (2007). MARCH-IX mediates ubiquitination and downregulation of ICAM-1. FEBS Lett. 581: 45—51. PMID 17174307 DOI:10.1016/j.febslet.2006.11.075
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:5344 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 2 жовтня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
ICAM1 angl Intercellular adhesion molecule 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 532 aminokislot a molekulyarna masa 57 825 ICAM1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1D3E 1D3I 1D3L 1IAM 1IC1 1MQ8 1P53 1Z7Z 2OZ4 3TCXIdentifikatoriSimvoliICAM1 BB2 CD54 P3 58 intercellular adhesion molecule 1Zovnishni ID OMIM 147840 MGI 96392 HomoloGene 168 GeneCards ICAM1Ontologiya genaMolekulyarna funkciya virus receptor activity GO 0032403 protein containing complex binding integrin binding GO 0001948 GO 0016582 protein binding transmembrane signaling receptor activity signaling receptor activityKlitinna komponenta integral component of membrane membrana focal adhesion klitinna membrana integral component of plasma membrane cell surface immunological synapse membrane raft ekzosoma external side of plasma membrane mizhklitinnij prostir GO 0005578 Pozaklitinna matricya collagen containing extracellular matrixBiologichnij proces leukocyte cell cell adhesion response to ionizing radiation establishment of endothelial barrier negative regulation of endothelial cell apoptotic process cellular response to organic substance heterophilic cell cell adhesion via plasma membrane cell adhesion molecules response to amino acid response to hypoxia positive regulation of actin filament polymerization GO 1904578 response to organic cyclic compound T cell antigen processing and presentation establishment of Sertoli cell barrier response to sulfur dioxide response to copper ion interferon gamma mediated signaling pathway positive regulation of nitric oxide biosynthetic process response to amphetamine cellular response to tumor necrosis factor regulation of leukocyte mediated cytotoxicity T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell extracellular matrix organization acute inflammatory response to antigenic stimulus sluh cellular response to alkaloid response to gonadotropin positive regulation of cellular extravasation GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity response to lipopolysaccharide regulation of cell adhesion adgeziya klitin cell adhesion mediated by integrin positive regulation of NF kappaB transcription factor activity negative regulation of extrinsic apoptotic signaling pathway via death domain receptors positive regulation of vasoconstriction cellular response to interleukin 1 cellular response to nutrient levels negative regulation of calcium ion transport regulation of cell shape membrane to membrane docking positive regulation of peptidyl tyrosine phosphorylation ovarian follicle development regulation of immune response positive regulation of ERK1 and ERK2 cascade regulation of ruffle assembly viral entry into host cell response to ethanol GO 0022415 viral process cellular response to lipopolysaccharide cellular response to hypoxia leukocyte migration cellular response to glucose stimulus response to insulin cellular response to interferon gamma cellular response to interleukin 6 cellular response to dexamethasone stimulus establishment of endothelial intestinal barrier positive regulation of leukocyte adhesion to vascular endothelial cell cellular response to leukemia inhibitory factor cell cell adhesion cytokine mediated signaling pathway T cell extravasation cellular response to amyloid betaDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3383 15894Ensembl ENSG00000090339 ENSMUSG00000037405UniProt P05362 P13597RefSeq mRNK NM 000201NM 010493RefSeq bilok NP 000192NP 034623Lokus UCSC Hr 19 10 27 10 29 MbHr 9 20 93 20 94 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCST SCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQ STAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVL LRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELF ENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQV HLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPL GPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDE RDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRD LEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLST YLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv klitini hazyayina dlya vhodu virusu receptoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinna adgeziya vzayemodiya hazyayin virus Lokalizovanij u membrani LiteraturaSimmons D Makgoba M W Seed B 1988 ICAM an adhesion ligand of LFA 1 is homologous to the neural cell adhesion molecule NCAM Nature 331 624 627 PMID 3340213 DOI 10 1038 331624a0 Staunton D E Marlin S D Stratowa C Dustin M L Springer T A 1988 Primary structure of ICAM 1 demonstrates interaction between members of the immunoglobulin and integrin supergene families Cell 52 925 933 PMID 3349522 DOI 10 1016 0092 8674 88 90434 5 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Walter N A R Stebbing J Messier W 2005 The potential significance of adaptive evolution and dimerization in chimpanzee intercellular cell adhesion molecules ICAMs J Theor Biol 232 339 346 PMID 15572059 DOI 10 1016 j jtbi 2004 08 024 Coscoy L Ganem D 2001 A viral protein that selectively downregulates ICAM 1 and B7 2 and modulates T cell costimulation J Clin Invest 107 1599 1606 PMID 11413168 DOI 10 1172 JCI12432 Hoer S Smith L Lehner P J 2007 MARCH IX mediates ubiquitination and downregulation of ICAM 1 FEBS Lett 581 45 51 PMID 17174307 DOI 10 1016 j febslet 2006 11 075PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 5344 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 2 zhovtnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi