Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

HMGB1 англ High mobility group box 1 білок який кодується однойменним геном розташованим у людей на короткому плечі 13 ї

HMGB1

HMGB1

HMGB1 (англ. High mobility group box 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 13-ї хромосоми. Довжина поліпептидного ланцюга білка становить 215 амінокислот, а молекулярна маса — 24 894.

HMGB1
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HMGB1, HMG1, HMG3, SBP-1, HMG-1, high mobility group box 1, HMGB-1
Зовнішні ІД OMIM: 163905 HomoloGene: 110676 GeneCards: HMGB1
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
3146
321622
Ensembl
ENSG00000189403
ENSDARG00000099175
UniProt
P09429
Q6NX86
RefSeq (мРНК)
NM_001313892
NM_001313893
NM_002128
NM_199555
RefSeq (білок)
NP_955849
Локус (UCSC) Хр. 13: 30.46 – 30.62 Mb н/д
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWK
TMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS
AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK
LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE
EDEEDEDEEEDDDDE

Задіяний у таких біологічних процесах як адаптивний імунітет, імунітет, вроджений імунітет, запальна відповідь, пошкодження ДНК, репарація ДНК, хемотаксис, рекомбінація ДНК, автофагія. Білок має сайт для зв'язування з ДНК. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані, хромосомах, ендосомах. Також секретований назовні.

Література

  • Wen L., Huang J.K., Johnson B.H., Reeck G.R. (1989). A human placental cDNA clone that encodes nonhistone chromosomal protein HMG-1. Nucleic Acids Res. 17: 1197—1214. PMID 2922262 DOI:10.1093/nar/17.3.1197
  • Ferrari S., Finelli P., Rocchi M., Bianchi M.E. (1996). The active gene that encodes human high mobility group 1 protein (HMG1) contains introns and maps to chromosome 13. Genomics. 35: 367—371. PMID 8661151 DOI:10.1006/geno.1996.0369
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Yuan F., Gu L., Guo S., Wang C., Li G.M. (2004). Evidence for involvement of HMGB1 protein in human DNA mismatch repair. J. Biol. Chem. 279: 20935—20940. PMID 15014079 DOI:10.1074/jbc.M401931200
  • DeMarco R.A., Fink M.P., Lotze M.T. (2005). Monocytes promote natural killer cell interferon gamma production in response to the endogenous danger signal HMGB1. Mol. Immunol. 42: 433—444. PMID 15607795 DOI:10.1016/j.molimm.2004.07.023
  • Bell C.W., Jiang W., Reich C.F., Pisetsky D.S. (2006). The extracellular release of HMGB1 during apoptotic cell death. Am. J. Physiol. 291: C1318—C1325. PMID 16855214 DOI:10.1152/ajpcell.00616.2005

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 26 березня 2016. Процитовано 27 лютого 2017.
  4. (англ.) . Архів оригіналу за 7 лютого 2017. Процитовано 27 лютого 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

HMGB1 angl High mobility group box 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 13 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 215 aminokislot a molekulyarna masa 24 894 HMGB1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2LY4 2RTU 2YRQIdentifikatoriSimvoliHMGB1 HMG1 HMG3 SBP 1 HMG 1 high mobility group box 1 HMGB 1Zovnishni ID OMIM 163905 HomoloGene 110676 GeneCards HMGB1Ontologiya genaMolekulyarna funkciya GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity bubble DNA binding DNA polymerase binding C X C chemokine binding transcription factor binding phosphatidylserine binding lipopolysaccharide binding lyase activity single stranded DNA binding damaged DNA binding GO 0001948 GO 0016582 protein binding DNA binding bending supercoiled DNA binding DNA binding four way junction DNA binding RAGE receptor binding chemoattractant activity RNA binding double stranded DNA binding double stranded RNA binding single stranded RNA binding cytokine activity calcium dependent protein kinase regulator activity protein kinase activator activity GO 0001105 transcription coactivator activity integrin bindingKlitinna komponenta citoplazma endosoma membrana transcription repressor complex extracellular region klitinne yadro cell surface klitinna membrana nukleoplazma hromosoma condensed chromosome endoplasmic reticulum Golgi intermediate compartment secretory granule lumen ficolin 1 rich granule lumen mizhklitinnij prostir early endosome neuron projection alphav beta3 integrin HMGB1 complexBiologichnij proces T helper 1 cell activation apoptotic DNA fragmentation adaptivna imunna vidpovid GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II positive regulation of DNA ligation positive regulation of JNK cascade cellular response to DNA damage stimulus apoptotic cell clearance positive regulation of cysteine type endopeptidase activity involved in apoptotic process positive regulation of toll like receptor 9 signaling pathway negative regulation of RNA polymerase II transcription preinitiation complex assembly positive regulation of dendritic cell differentiation positive regulation of DNA binding neuron projection development negative regulation of blood vessel endothelial cell migration positive regulation of interleukin 12 production positive regulation of monocyte chemotaxis activation of innate immune response DNA ligation involved in DNA repair vrodzhenij imunitet inflammatory response GO 0100026 Reparaciya DNK positive regulation of MAPK cascade positive regulation of activated T cell proliferation DNA geometric change DNA recombination inflammatory response to antigenic stimulus positive regulation of interleukin 10 production proces imunnoyi sistemi GO 1901227 negative regulation of transcription by RNA polymerase II regulation of restriction endodeoxyribonuclease activity hemotaksis positive regulation of mismatch repair negative regulation of CD4 positive alpha beta T cell differentiation positive regulation of cytosolic calcium ion concentration T helper 1 cell differentiation dendritic cell chemotaxis avtofagiya neutrophil clearance V D J rekombinaciya positive regulation of apoptotic process DNA topological change positive chemotaxis toll like receptor signaling pathway neutrophil degranulation rozvitok oka myeloid dendritic cell activation positive regulation of protein phosphorylation endothelial cell proliferation plasmacytoid dendritic cell activation macrophage activation involved in immune response regulation of tolerance induction regulation of T cell mediated immune response to tumor cell base excision repair regulation of autophagy lung development activation of protein kinase activity positive regulation of interferon alpha production positive regulation of interferon beta production positive regulation of interleukin 6 production positive regulation of tumor necrosis factor production positive regulation of toll like receptor 2 signaling pathway positive regulation of toll like receptor 4 signaling pathway endothelial cell chemotaxis positive regulation of innate immune response positive regulation of myeloid cell differentiation positive regulation of glycogen catabolic process regulation of protein kinase activity GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II response to glucocorticoid positive regulation of ERK1 and ERK2 cascade positive regulation of wound healing positive regulation of NIK NF kappaB signaling positive regulation of sprouting angiogenesis negative regulation of apoptotic cell clearance regulation of nucleotide excision repair regulation of signaling receptor activity remodelyuvannya hromatinu positive regulation of autophagy GO 0007571 rozvojovij proces positive regulation of blood vessel endothelial cell migration cell chemotaxis cellular response to lipopolysaccharide positive regulation of vascular endothelial cell proliferation negative regulation of interferon gamma production positive regulation of monocyte chemotactic protein 1 production cellular response to interleukin 7Dzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3146 321622Ensembl ENSG00000189403 ENSDARG00000099175UniProt P09429 Q6NX86RefSeq mRNK NM 001313892 NM 001313893 NM 002128NM 199555RefSeq bilok NP 001300821 NP 001300822 NP 002119 NP 001350590 NP 001357268NP 001357269 NP 001357270 NP 001300821 1 NP 001300822 1 NP 002119 1NP 955849Lokus UCSC Hr 13 30 46 30 62 Mbn dPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWK TMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE EDEEDEDEEEDDDDE A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak adaptivnij imunitet imunitet vrodzhenij imunitet zapalna vidpovid poshkodzhennya DNK reparaciya DNK hemotaksis rekombinaciya DNK avtofagiya Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u klitinnij membrani citoplazmi yadri membrani hromosomah endosomah Takozh sekretovanij nazovni LiteraturaWen L Huang J K Johnson B H Reeck G R 1989 A human placental cDNA clone that encodes nonhistone chromosomal protein HMG 1 Nucleic Acids Res 17 1197 1214 PMID 2922262 DOI 10 1093 nar 17 3 1197 Ferrari S Finelli P Rocchi M Bianchi M E 1996 The active gene that encodes human high mobility group 1 protein HMG1 contains introns and maps to chromosome 13 Genomics 35 367 371 PMID 8661151 DOI 10 1006 geno 1996 0369 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Yuan F Gu L Guo S Wang C Li G M 2004 Evidence for involvement of HMGB1 protein in human DNA mismatch repair J Biol Chem 279 20935 20940 PMID 15014079 DOI 10 1074 jbc M401931200 DeMarco R A Fink M P Lotze M T 2005 Monocytes promote natural killer cell interferon gamma production in response to the endogenous danger signal HMGB1 Mol Immunol 42 433 444 PMID 15607795 DOI 10 1016 j molimm 2004 07 023 Bell C W Jiang W Reich C F Pisetsky D S 2006 The extracellular release of HMGB1 during apoptotic cell death Am J Physiol 291 C1318 C1325 PMID 16855214 DOI 10 1152 ajpcell 00616 2005PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 26 bereznya 2016 Procitovano 27 lyutogo 2017 angl Arhiv originalu za 7 lyutogo 2017 Procitovano 27 lyutogo 2017 Div takozhHromosoma 13 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ