HLA-G (англ. Major histocompatibility complex, class I, G) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 338 амінокислот, а молекулярна маса — 38 224.
HLA-G | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | HLA-G, MHC-G, major histocompatibility complex, class I, G | ||||||||||||||||
Зовнішні ІД | OMIM: 142871 MGI: 95915 HomoloGene: 133255 GeneCards: HLA-G | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 6: 29.83 – 29.83 Mb | Хр. 17: 37.58 – 37.59 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MVVMAPRTLF | LLLSGALTLT | ETWAGSHSMR | YFSAAVSRPG | RGEPRFIAMG | ||||
YVDDTQFVRF | DSDSACPRME | PRAPWVEQEG | PEYWEEETRN | TKAHAQTDRM | ||||
NLQTLRGYYN | QSEASSHTLQ | WMIGCDLGSD | GRLLRGYEQY | AYDGKDYLAL | ||||
NEDLRSWTAA | DTAAQISKRK | CEAANVAEQR | RAYLEGTCVE | WLHRYLENGK | ||||
EMLQRADPPK | THVTHHPVFD | YEATLRCWAL | GFYPAEIILT | WQRDGEDQTQ | ||||
DVELVETRPA | GDGTFQKWAA | VVVPSGEEQR | YTCHVQHEGL | PEPLMLRWKQ | ||||
SSLPTIPIMG | IVAGLVVLAA | VVTGAAVAAV | LWRKKSSD |
Задіяний у такому біологічному процесі, як імунітет. Локалізований у мембрані.
Література
- Shukla H., Swaroop A., Srivastava R., Weissman S.M. (1990). The mRNA of a human class I gene HLA G/HLA 6.0 exhibits a restricted pattern of expression. Nucleic Acids Res. 18: 2189—2189. PMID 2336406 DOI:10.1093/nar/18.8.2189
- Geraghty D.E., Koller B.H., Orr H.T. (1987). A human major histocompatibility complex class I gene that encodes a protein with a shortened cytoplasmic segment. Proc. Natl. Acad. Sci. U.S.A. 84: 9145—9149. PMID 3480534 DOI:10.1073/pnas.84.24.9145
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:4964 (англ.) . Процитовано 6 вересня 2017.
- (англ.) . Архів оригіналу за 19 липня 2017. Процитовано 6 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до . |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
HLA G angl Major histocompatibility complex class I G bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 338 aminokislot a molekulyarna masa 38 224 HLA GNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3KYO 1YDP 2D31 2DYP 3BZE 3CDG 3CII 3KYNIdentifikatoriSimvoliHLA G MHC G major histocompatibility complex class I GZovnishni ID OMIM 142871 MGI 95915 HomoloGene 133255 GeneCards HLA GOntologiya genaMolekulyarna funkciya protein homodimerization activity signaling receptor binding peptide antigen binding GO 0001948 GO 0016582 protein binding identical protein binding CD8 receptor bindingKlitinna komponenta integral component of membrane phagocytic vesicle membrane early endosome membrane membrana Golgi membrane MHC class I protein complex ER to Golgi transport vesicle membrane integral component of lumenal side of endoplasmic reticulum membrane recycling endosome membrane extracellular region klitinna membrana endosoma early endosome endoplazmatichnij retikulum endoplasmic reticulum membrane filopodium membrane cis Golgi network membrane cell projection mizhklitinnij prostir external side of plasma membraneBiologichnij proces antigen processing and presentation of exogenous peptide antigen via MHC class I TAP dependent positive regulation of tolerance induction positive regulation of interleukin 12 production interferon gamma mediated signaling pathway proces imunnoyi sistemi positive regulation of regulatory T cell differentiation positive regulation of T cell tolerance induction antigen processing and presentation of exogenous peptide antigen via MHC class I TAP independent cellular defense response negative regulation of T cell proliferation negative regulation of immune response type I interferon signaling pathway regulation of immune response immune response inhibiting cell surface receptor signaling pathway negative regulation of dendritic cell differentiation antigen processing and presentation of peptide antigen via MHC class I negative regulation of T cell mediated cytotoxicity positive regulation of T cell mediated cytotoxicity peripheral B cell tolerance induction antigen processing and presentation of endogenous peptide antigen via MHC class Ib positive regulation of natural killer cell cytokine production GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid negative regulation of angiogenesis protection from natural killer cell mediated cytotoxicity negative regulation of natural killer cell mediated cytotoxicity negative regulation of protein kinase B signaling positive regulation of macrophage cytokine production protein homotrimerization negative regulation of G0 to G1 transition positive regulation of endothelial cell apoptotic process positive regulation of cellular senescence antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway TAP independentDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3135 14991Ensembl ENSG00000230413 ENSG00000233095 ENSG00000237216 ENSG00000276051 ENSG00000204632ENSG00000235346 ENSG00000235680 ENSG00000206506 ENSMUSG00000016206UniProt P17693 Q31093RefSeq mRNK NM 002127 NM 001363567 NM 001384280 NM 001384290NM 013819RefSeq bilok NP 002118 NP 001350496NP 038847Lokus UCSC Hr 6 29 83 29 83 MbHr 17 37 58 37 59 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMG YVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRM NLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLAL NEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGK EMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQ DVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ SSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takomu biologichnomu procesi yak imunitet Lokalizovanij u membrani LiteraturaShukla H Swaroop A Srivastava R Weissman S M 1990 The mRNA of a human class I gene HLA G HLA 6 0 exhibits a restricted pattern of expression Nucleic Acids Res 18 2189 2189 PMID 2336406 DOI 10 1093 nar 18 8 2189 Geraghty D E Koller B H Orr H T 1987 A human major histocompatibility complex class I gene that encodes a protein with a shortened cytoplasmic segment Proc Natl Acad Sci U S A 84 9145 9149 PMID 3480534 DOI 10 1073 pnas 84 24 9145PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4964 angl Procitovano 6 veresnya 2017 angl Arhiv originalu za 19 lipnya 2017 Procitovano 6 veresnya 2017 Div takozhHromosoma 6 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij