Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
H3F3A (англ. H3 histone family member 3B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 136 амінокислот, а молекулярна маса — 15 328.
| H3F3A | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | H3-3A, H3.3A, H3F3, H3 histone, family 3A, H3 histone family member 3A, H3.3 histone A, H3F3A, H3-3B | ||||||||||||||||
| Зовнішні ІД | OMIM: 601128 MGI: 1097686 HomoloGene: 134170 GeneCards: H3-3A | ||||||||||||||||
| |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 1: 226.06 – 226.07 Mb | Хр. 1: 180.63 – 180.64 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MARTKQTARK | STGGKAPRKQ | LATKAARKSA | PSTGGVKKPH | RYRPGTVALR | ||||
| EIRRYQKSTE | LLIRKLPFQR | LVREIAQDFK | TDLRFQSAAI | GALQEASEAY | ||||
| LVGLFEDTNL | CAIHAKRVTI | MPKDIQLARR | IRGERA |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі як ацетиляція. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.
Література
- Wells D., Kedes L. (1985). Structure of a human histone cDNA: evidence that basally expressed histone genes have intervening sequences and encode polyadenylylated mRNAs. Proc. Natl. Acad. Sci. U.S.A. 82: 2834—2838. PMID 2859593 DOI:10.1073/pnas.82.9.2834
- Wells D., Hoffman D., Kedes L. (1987). Unusual structure, evolutionary conservation of non-coding sequences and numerous pseudogenes characterize the human H3.3 histone multigene family. Nucleic Acids Res. 15: 2871—2889. PMID 3031613 DOI:10.1093/nar/15.7.2871
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Lachner M., O'Carroll D., Rea S., Mechtler K., Jenuwein T. (2001). Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins. Nature. 410: 116—120. PMID 11242053 DOI:10.1038/35065132
- Goto H., Yasui Y., Nigg E.A., Inagaki M. (2002). Aurora-B phosphorylates Histone H3 at serine28 with regard to the mitotic chromosome condensation. Genes Cells. 7: 11—17. PMID 11856369 DOI:10.1046/j.1356-9597.2001.00498.x
- Preuss U., Landsberg G., Scheidtmann K.H. (2003). Novel mitosis-specific phosphorylation of histone H3 at Thr11 mediated by Dlk/ZIP kinase. Nucleic Acids Res. 31: 878—885. PMID 12560483 DOI:10.1093/nar/gkg176
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 19 липня 2017. Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 25 серпня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
H3F3A angl H3 histone family member 3B bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 136 aminokislot a molekulyarna masa 15 328 H3F3ANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4H9O 5BNX 3JVK 5DWQ 4L58 4TMP 5DX0 4H9S 4W5A 3AV2 3WTP 4HGA 4GUS 4GY5 3MUK 3QLC 4H9Q 4N4I 4GU0 4GNE 5BNV 2L43 3MUL 4H9P 3QLA 4QQ4 4GNF 4U7T 3ASK 4O62 4GNG 4GUR 4H9N 4H9R 3ASL 3QL9 5AY8 5JA4IdentifikatoriSimvoliH3 3A H3 3A H3F3 H3 histone family 3A H3 histone family member 3A H3 3 histone A H3F3A H3 3BZovnishni ID OMIM 601128 MGI 1097686 HomoloGene 134170 GeneCards H3 3AOntologiya genaMolekulyarna funkciya GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding DNA binding GO 0031493 histone binding GO 0001948 GO 0016582 protein binding protein heterodimerization activity RNA polymerase II core promoter sequence specific DNA binding nucleosomal DNA bindingKlitinna komponenta nukleoplazma hromosoma extracellular region nuclear chromosome ekzosoma Tilce Barra Nukleosoma klitinne yadro GO 0009327 protein containing complexBiologichnij proces telomere organization epigenetic maintenance of chromatin in transcription competent conformation zsidannya krovi positive regulation of cell growth rDNA heterochromatin assembly negative regulation of gene expression epigenetic male gonad development multicellular organism growth single fertilization proliferaciya embryo implantation negative regulation of chromosome condensation spermatid development nucleus organization osteoblast differentiation pericentric heterochromatin assembly Oogenez subtelomeric heterochromatin assembly Spermatogenez GO 1903097 GO 1903098 GO 1903099 regulation of centromere complex assembly muscle cell differentiation nucleosome assembly brain development response to hormone GO 1905616 regulation of gene silencing by miRNA regulation of megakaryocyte differentiation regulation of hematopoietic stem cell differentiationDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez3020 15078Ensembl ENSG00000163041 ENSMUSG00000060743UniProt P84243 P84244RefSeq mRNK NM 002107NM 008210RefSeq bilok NP 005315NP 032236 NP 032237Lokus UCSC Hr 1 226 06 226 07 MbHr 1 180 63 180 64 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALR EIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAY LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak acetilyaciya Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri hromosomah LiteraturaWells D Kedes L 1985 Structure of a human histone cDNA evidence that basally expressed histone genes have intervening sequences and encode polyadenylylated mRNAs Proc Natl Acad Sci U S A 82 2834 2838 PMID 2859593 DOI 10 1073 pnas 82 9 2834 Wells D Hoffman D Kedes L 1987 Unusual structure evolutionary conservation of non coding sequences and numerous pseudogenes characterize the human H3 3 histone multigene family Nucleic Acids Res 15 2871 2889 PMID 3031613 DOI 10 1093 nar 15 7 2871 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Lachner M O Carroll D Rea S Mechtler K Jenuwein T 2001 Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins Nature 410 116 120 PMID 11242053 DOI 10 1038 35065132 Goto H Yasui Y Nigg E A Inagaki M 2002 Aurora B phosphorylates Histone H3 at serine28 with regard to the mitotic chromosome condensation Genes Cells 7 11 17 PMID 11856369 DOI 10 1046 j 1356 9597 2001 00498 x Preuss U Landsberg G Scheidtmann K H 2003 Novel mitosis specific phosphorylation of histone H3 at Thr11 mediated by Dlk ZIP kinase Nucleic Acids Res 31 878 885 PMID 12560483 DOI 10 1093 nar gkg176PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 19 lipnya 2017 Procitovano 25 serpnya 2017 angl Arhiv originalu za 31 serpnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi