GYPC (англ. Glycophorin C (Gerbich blood group)) – білок, який кодується однойменним геном, розташованим у людей на 2-й хромосомі. Довжина поліпептидного ланцюга білка становить 128 амінокислот, а молекулярна маса — 13 811.
GYPC | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | GYPC, CD236, CD236R, GE, GPC, GPD, GYPD, PAS-2, PAS-2', glycophorin C (Gerbich blood group), GE:GPC:GPD:GYPD | ||||||||||||||||
Зовнішні ІД | OMIM: 110750 MGI: 1098566 HomoloGene: 128415 GeneCards: GYPC | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 126.66 – 126.7 Mb | Хр. 18: 32.66 – 32.69 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MWSTRSPNST | AWPLSLEPDP | GMASASTTMH | TTTIAEPDPG | MSGWPDGRME | ||||
TSTPTIMDIV | VIAGVIAAVA | IVLVSLLFVM | LRYMYRHKGT | YHTNEAKGTE | ||||
FAESADAALQ | GDPALQDAGD | SSRKEYFI |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з сіаловими кислотами. Локалізований у клітинній мембрані, мембрані.
Література
- High S., Tanner M.J.A. (1987). Human erythrocyte membrane sialoglycoprotein beta. The cDNA sequence suggests the absence of a cleaved N-terminal signal sequence. Biochem. J. 243: 277—280. PMID 3606576 DOI:10.1042/bj2430277
- le van Kim C., Mitjavila M.T., Clerget M., Cartron J.-P., Colin Y. (1990). An ubiquitous isoform of glycophorin C is produced by alternative splicing. Nucleic Acids Res. 18: 3076—3076. PMID 2349119 DOI:10.1093/nar/18.10.3076
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Dahr W., Beyreuther K., Kordowicz M., Krueger J. (1982). N-terminal amino acid sequence of sialoglycoprotein D (glycophorin C) from human erythrocyte membranes. Eur. J. Biochem. 125: 57—62. PMID 7106126 DOI:10.1111/j.1432-1033.1982.tb06650.x
- El-Maliki B., Blanchard D., Dahr W., Beyreuther K., Cartron J.-P. (1989). Structural homology between glycophorins C and D of human erythrocytes. Eur. J. Biochem. 183: 639—643. PMID 2776757 DOI:10.1111/j.1432-1033.1989.tb21093.x
- High S., Tanner M.J.A., Macdonald E.N., Anstee D.J. (1989). Rearrangements of the red-cell membrane glycophorin C (sialoglycoprotein beta) gene. A further study of alterations in the glycophorin C gene. Biochem. J. 262: 47—54. PMID 2818576 DOI:10.1042/bj2620047
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:4704 (англ.) . Процитовано 18 вересня 2017.
- (англ.) . Архів оригіналу за 4 вересня 2017. Процитовано 18 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
GYPC angl Glycophorin C Gerbich blood group bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na 2 j hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 128 aminokislot a molekulyarna masa 13 811 GYPCNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2EJYIdentifikatoriSimvoliGYPC CD236 CD236R GE GPC GPD GYPD PAS 2 PAS 2 glycophorin C Gerbich blood group GE GPC GPD GYPDZovnishni ID OMIM 110750 MGI 1098566 HomoloGene 128415 GeneCards GYPCOntologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding signaling receptor binding protein homodimerization activity cell adhesion molecule bindingKlitinna komponenta integral component of membrane cortical cytoskeleton integral component of plasma membrane membrana klitinna membrana extrinsic component of plasma membraneBiologichnij proces leukocyte migration homophilic cell adhesion via plasma membrane adhesion molecules heterophilic cell cell adhesion via plasma membrane cell adhesion molecules cell recognitionDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez2995 71683Ensembl ENSG00000136732 ENSMUSG00000090523UniProt P04921 Q78HU7RefSeq mRNK NM 001256584 NM 002101 NM 016815NM 001048207 NM 027863 NM 001347610RefSeq bilok NP 001243513 NP 002092 NP 058131NP 001041672 NP 001334539Lokus UCSC Hr 2 126 66 126 7 MbHr 18 32 66 32 69 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRME TSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTE FAESADAALQGDPALQDAGDSSRKEYFI A Alanin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z sialovimi kislotami Lokalizovanij u klitinnij membrani membrani LiteraturaHigh S Tanner M J A 1987 Human erythrocyte membrane sialoglycoprotein beta The cDNA sequence suggests the absence of a cleaved N terminal signal sequence Biochem J 243 277 280 PMID 3606576 DOI 10 1042 bj2430277 le van Kim C Mitjavila M T Clerget M Cartron J P Colin Y 1990 An ubiquitous isoform of glycophorin C is produced by alternative splicing Nucleic Acids Res 18 3076 3076 PMID 2349119 DOI 10 1093 nar 18 10 3076 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Dahr W Beyreuther K Kordowicz M Krueger J 1982 N terminal amino acid sequence of sialoglycoprotein D glycophorin C from human erythrocyte membranes Eur J Biochem 125 57 62 PMID 7106126 DOI 10 1111 j 1432 1033 1982 tb06650 x El Maliki B Blanchard D Dahr W Beyreuther K Cartron J P 1989 Structural homology between glycophorins C and D of human erythrocytes Eur J Biochem 183 639 643 PMID 2776757 DOI 10 1111 j 1432 1033 1989 tb21093 x High S Tanner M J A Macdonald E N Anstee D J 1989 Rearrangements of the red cell membrane glycophorin C sialoglycoprotein beta gene A further study of alterations in the glycophorin C gene Biochem J 262 47 54 PMID 2818576 DOI 10 1042 bj2620047PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4704 angl Procitovano 18 veresnya 2017 angl Arhiv originalu za 4 veresnya 2017 Procitovano 18 veresnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi