Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
GSTM4 (англ. Glutathione S-transferase mu 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 218 амінокислот, а молекулярна маса — 25 561.
| GSTM4 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | GSTM4, GSTM4-4, GTM4, glutathione S-transferase mu 4 | ||||||||||||||||
| Зовнішні ІД | OMIM: 138333 MGI: 95862 HomoloGene: 37357 GeneCards: GSTM4 | ||||||||||||||||
| |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 1: 109.66 – 109.67 Mb | Хр. 3: 107.95 – 107.95 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MSMTLGYWDI | RGLAHAIRLL | LEYTDSSYEE | KKYTMGDAPD | YDRSQWLNEK | ||||
| FKLGLDFPNL | PYLIDGAHKI | TQSNAILCYI | ARKHNLCGET | EEEKIRVDIL | ||||
| ENQAMDVSNQ | LARVCYSPDF | EKLKPEYLEE | LPTMMQHFSQ | FLGKRPWFVG | ||||
| DKITFVDFLA | YDVLDLHRIF | EPNCLDAFPN | LKDFISRFEG | LEKISAYMKS | ||||
| SRFLPKPLYT | RVAVWGNK |
Кодований геном білок за функцією належить до трансфераз. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у цитоплазмі.
Література
- Zhong S., Spurr N.K., Hayes J.D., Wolf C.R. (1993). Deduced amino acid sequence, gene structure and chromosomal location of a novel human class Mu glutathione S-transferase, GSTM4. Biochem. J. 291: 41—50. PMID 8471052 DOI:10.1042/bj2910041
- Ross V.L., Board P.G. (1993). Molecular cloning and heterologous expression of an alternatively spliced human Mu class glutathione S-transferase transcript. Biochem. J. 294: 373—380. PMID 8373352 DOI:10.1042/bj2940373
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Taylor J.B., Oliver J., Sherrington R., Pemble S.E. (1991). Structure of human glutathione S-transferase class Mu genes. Biochem. J. 274: 587—593. PMID 2006920 DOI:10.1042/bj2740587
- Comstock K.E., Widersten M., Hao X.Y., Henner W.D., Mannervik B. (1994). A comparison of the enzymatic and physicochemical properties of human glutathione transferase M4-4 and three other human Mu class enzymes. Arch. Biochem. Biophys. 311: 487—495. PMID 8203914 DOI:10.1006/abbi.1994.1266
- Patskovsky Y.V., Patskovska L.N., Listowsky I. (1999). An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases. Biochemistry. 38: 16187—16194. PMID 10587441 DOI:10.1021/bi991714t
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:4636 (англ.) . Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 26 жовтня 2017. Процитовано 25 серпня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
GSTM4 angl Glutathione S transferase mu 4 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 218 aminokislot a molekulyarna masa 25 561 GSTM4Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4GTUIdentifikatoriSimvoliGSTM4 GSTM4 4 GTM4 glutathione S transferase mu 4Zovnishni ID OMIM 138333 MGI 95862 HomoloGene 37357 GeneCards GSTM4Ontologiya genaMolekulyarna funkciya transferase activity enzyme binding glutathione transferase activity GO 0001948 GO 0016582 protein binding protein homodimerization activity glutathione bindingKlitinna komponenta citoplazma gialoplazma intercellular bridgeBiologichnij proces obmin rechovin glutathione metabolic process glutathione derivative biosynthetic process nitrobenzene metabolic process xenobiotic catabolic process long chain fatty acid biosynthetic processDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez2948 14865Ensembl ENSG00000168765 ENSMUSG00000027890UniProt Q03013 Q8R5I6RefSeq mRNK NM 000850 NM 147148 NM 147149NM 001160411 NM 026764RefSeq bilok NP 000841 NP 671489NP 001153883 NP 081040Lokus UCSC Hr 1 109 66 109 67 MbHr 3 107 95 107 95 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEK FKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDIL ENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVG DKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKS SRFLPKPLYTRVAVWGNK A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do transferaz Zadiyanij u takomu biologichnomu procesi yak polimorfizm Lokalizovanij u citoplazmi LiteraturaZhong S Spurr N K Hayes J D Wolf C R 1993 Deduced amino acid sequence gene structure and chromosomal location of a novel human class Mu glutathione S transferase GSTM4 Biochem J 291 41 50 PMID 8471052 DOI 10 1042 bj2910041 Ross V L Board P G 1993 Molecular cloning and heterologous expression of an alternatively spliced human Mu class glutathione S transferase transcript Biochem J 294 373 380 PMID 8373352 DOI 10 1042 bj2940373 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Taylor J B Oliver J Sherrington R Pemble S E 1991 Structure of human glutathione S transferase class Mu genes Biochem J 274 587 593 PMID 2006920 DOI 10 1042 bj2740587 Comstock K E Widersten M Hao X Y Henner W D Mannervik B 1994 A comparison of the enzymatic and physicochemical properties of human glutathione transferase M4 4 and three other human Mu class enzymes Arch Biochem Biophys 311 487 495 PMID 8203914 DOI 10 1006 abbi 1994 1266 Patskovsky Y V Patskovska L N Listowsky I 1999 An asparagine phenylalanine substitution accounts for catalytic differences between hGSTM3 3 and other human class mu glutathione S transferases Biochemistry 38 16187 16194 PMID 10587441 DOI 10 1021 bi991714tPrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4636 angl Procitovano 25 serpnya 2017 angl Arhiv originalu za 26 zhovtnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi