GSTM3 (англ. Glutathione S-transferase mu 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 225 амінокислот, а молекулярна маса — 26 560.
GSTM3 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | GSTM3, GST5, GSTB, GSTM3-3, GTM3, glutathione S-transferase mu 3 (brain), glutathione S-transferase mu 3 | ||||||||||||||||
Зовнішні ІД | OMIM: 138390 MGI: 1309466 HomoloGene: 658 GeneCards: GSTM3 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 109.73 – 109.74 Mb | Хр. 3: 107.8 – 107.81 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MSCESSMVLG | YWDIRGLAHA | IRLLLEFTDT | SYEEKRYTCG | EAPDYDRSQW | ||||
LDVKFKLDLD | FPNLPYLLDG | KNKITQSNAI | LRYIARKHNM | CGETEEEKIR | ||||
VDIIENQVMD | FRTQLIRLCY | SSDHEKLKPQ | YLEELPGQLK | QFSMFLGKFS | ||||
WFAGEKLTFV | DFLTYDILDQ | NRIFDPKCLD | EFPNLKAFMC | RFEALEKIAA | ||||
YLQSDQFCKM | PINNKMAQWG | NKPVC |
Кодований геном білок за функцією належить до трансфераз. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у цитоплазмі.
Література
- Patskovsky Y.V., Huang M.Q., Takayama T., Listowsky I., Pearson W.R. (1999). Distinctive structure of the human GSTM3 gene-inverted orientation relative to the mu class glutathione transferase gene cluster. Arch. Biochem. Biophys. 361: 85—93. PMID 9882431 DOI:10.1006/abbi.1998.0964
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Ross V.L., Board P.G. (1993). Molecular cloning and heterologous expression of an alternatively spliced human Mu class glutathione S-transferase transcript. Biochem. J. 294: 373—380. PMID 8373352 DOI:10.1042/bj2940373
- Hussey A.J., Hayes J.D. (1993). Human Mu-class glutathione S-transferases present in liver, skeletal muscle and testicular tissue. Biochim. Biophys. Acta. 1203: 131—141. PMID 8218382 DOI:10.1016/0167-4838(93)90047-U
- Patskovsky Y.V., Patskovska L.N., Listowsky I. (1999). An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases. Biochemistry. 38: 16187—16194. PMID 10587441 DOI:10.1021/bi991714t
- Campbell E., Takahashi Y., Abramovitz M., Peretz M., Listowsky I. (1990). A distinct human testis and brain mu-class glutathione S-transferase. Molecular cloning and characterization of a form present even in individuals lacking hepatic type mu isoenzymes. J. Biol. Chem. 265: 9188—9193. PMID 2345169
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 1 квітня 2016. Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 4 грудня 2016. Процитовано 25 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
GSTM3 angl Glutathione S transferase mu 3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 225 aminokislot a molekulyarna masa 26 560 GSTM3Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3GTUIdentifikatoriSimvoliGSTM3 GST5 GSTB GSTM3 3 GTM3 glutathione S transferase mu 3 brain glutathione S transferase mu 3Zovnishni ID OMIM 138390 MGI 1309466 HomoloGene 658 GeneCards GSTM3Ontologiya genaMolekulyarna funkciya transferase activity enzyme binding glutathione transferase activity protein homodimerization activity glutathione binding identical protein binding GO 0001948 GO 0016582 protein bindingKlitinna komponenta citoplazma gialoplazma sperm fibrous sheath ekzosoma klitinne yadro intercellular bridgeBiologichnij proces cellular detoxification of nitrogen compound obmin rechovin nitrobenzene metabolic process xenobiotic catabolic process glutathione derivative biosynthetic process glutathione metabolic process response to estrogen establishment of blood nerve barrierDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2947 14866Ensembl ENSG00000134202 ENSMUSG00000004032UniProt P21266 Q6FGJ9 P48774RefSeq mRNK NM 000849NM 010360RefSeq bilok NP 000840 NP 000840 2NP 034490Lokus UCSC Hr 1 109 73 109 74 MbHr 3 107 8 107 81 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQW LDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIR VDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFS WFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAA YLQSDQFCKMPINNKMAQWGNKPVC A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do transferaz Zadiyanij u takomu biologichnomu procesi yak polimorfizm Lokalizovanij u citoplazmi LiteraturaPatskovsky Y V Huang M Q Takayama T Listowsky I Pearson W R 1999 Distinctive structure of the human GSTM3 gene inverted orientation relative to the mu class glutathione transferase gene cluster Arch Biochem Biophys 361 85 93 PMID 9882431 DOI 10 1006 abbi 1998 0964 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Ross V L Board P G 1993 Molecular cloning and heterologous expression of an alternatively spliced human Mu class glutathione S transferase transcript Biochem J 294 373 380 PMID 8373352 DOI 10 1042 bj2940373 Hussey A J Hayes J D 1993 Human Mu class glutathione S transferases present in liver skeletal muscle and testicular tissue Biochim Biophys Acta 1203 131 141 PMID 8218382 DOI 10 1016 0167 4838 93 90047 U Patskovsky Y V Patskovska L N Listowsky I 1999 An asparagine phenylalanine substitution accounts for catalytic differences between hGSTM3 3 and other human class mu glutathione S transferases Biochemistry 38 16187 16194 PMID 10587441 DOI 10 1021 bi991714t Campbell E Takahashi Y Abramovitz M Peretz M Listowsky I 1990 A distinct human testis and brain mu class glutathione S transferase Molecular cloning and characterization of a form present even in individuals lacking hepatic type mu isoenzymes J Biol Chem 265 9188 9193 PMID 2345169PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 1 kvitnya 2016 Procitovano 25 serpnya 2017 angl Arhiv originalu za 4 grudnya 2016 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi