FOLR1 (англ. Folate receptor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 257 амінокислот, а молекулярна маса — 29 819.
FOLR1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | FOLR1, FBP, FOLR, Folate receptor 1, folate receptor 1 (adult), folate receptor alpha, FRalpha, NCFTD | ||||||||||||||||
Зовнішні ІД | OMIM: 136430 MGI: 95568 HomoloGene: 7322 GeneCards: FOLR1 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
cerebral folate receptor alpha deficiency | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 11: 72.19 – 72.2 Mb | Хр. 7: 101.51 – 101.52 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAQRMTTQLL | LLLVWVAVVG | EAQTRIAWAR | TELLNVCMNA | KHHKEKPGPE | ||||
DKLHEQCRPW | RKNACCSTNT | SQEAHKDVSY | LYRFNWNHCG | EMAPACKRHF | ||||
IQDTCLYECS | PNLGPWIQQV | DQSWRKERVL | NVPLCKEDCE | QWWEDCRTSY | ||||
TCKSNWHKGW | NWTSGFNKCA | VGAACQPFHF | YFPTPTVLCN | EIWTHSYKVS | ||||
NYSRGSGRCI | QMWFDPAQGN | PNEEVARFYA | AAMSGAGPWA | AWPFLLSLAL | ||||
MLLWLLS |
Кодований геном білок за функцією належить до рецепторів. Задіяний у такому біологічному процесі, як транспорт. Локалізований у клітинній мембрані, мембрані, цитоплазматичних везикулах, ендосомах. Також секретований назовні.
Захворювання
Мутації гена FOLR1, що кодує рецептор, можуть призводити до розвитку , при якій рівні у спинномозковій рідині значно знижені, незважаючи на нормальні рівні у сироватці крові.
Література
- Lacey S.W., Sanders J.M., Rothberg K.G., Anderson R.G.W., Kamen B.A. (1989). Complementary DNA for the folate binding protein correctly predicts anchoring to the membrane by glycosyl-phosphatidylinositol. J. Clin. Invest. 84: 715—720. PMID 2527252 DOI:10.1172/JCI114220
- Sadasivan E., Cedeno M., Rothenberg S.P. (1992). Genomic organization of the gene and a related pseudogene for a human folate binding protein. Biochim. Biophys. Acta. 1131: 91—94. PMID 1581364 DOI:10.1016/0167-4781(92)90103-7
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Yan W., Ratnam M. (1995). Preferred sites of glycosylphosphatidylinositol modification in folate receptors and constraints in the primary structure of the hydrophobic portion of the signal. Biochemistry. 34: 14594—14600. PMID 7578066 DOI:10.1021/bi00044a039
- Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F. (2008). Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry. Proteomics. 8: 3833—3847. PMID 18780401 DOI:10.1002/pmic.200701057
- Elwood P.C. (1989). Molecular cloning and characterization of the human folate-binding protein cDNA from placenta and malignant tissue culture (KB) cells. J. Biol. Chem. 264: 14893—14901. PMID 2768245
Примітки
- Захворювання, генетично пов'язані з FOLR1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:3791 (англ.) . Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 19 вересня 2017. Процитовано 8 вересня 2017.
- Pope S., Artuch R., Heales S., Rahman S. Cerebral folate deficiency: Analytical tests and differential diagnosis : ( )[англ.] // [en] : journal. — 2019. — March. — DOI:10.1002/jimd.12092. — PMID 30916789.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
FOLR1 angl Folate receptor 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 257 aminokislot a molekulyarna masa 29 819 FOLR1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4KM6 4KM7 4KMX 4LRHIdentifikatoriSimvoliFOLR1 FBP FOLR Folate receptor 1 folate receptor 1 adult folate receptor alpha FRalpha NCFTDZovnishni ID OMIM 136430 MGI 95568 HomoloGene 7322 GeneCards FOLR1Pov yazani genetichni zahvoryuvannyacerebral folate receptor alpha deficiency Ontologiya genaMolekulyarna funkciya methotrexate binding folic acid receptor activity folic acid transmembrane transporter activity folic acid binding signaling receptor activityKlitinna komponenta anchored component of external side of plasma membrane extracellular region brush border clathrin coated vesicle ER to Golgi transport vesicle membrane anchored component of membrane Golgi membrane klitinne yadro integral component of plasma membrane apical plasma membrane membrana cell surface endoplasmic reticulum membrane brush border membrane basolateral plasma membrane klitinna membrana GO 0016023 cytoplasmic vesicle endosoma endoplasmic reticulum Golgi intermediate compartment membrane anchored component of plasma membrane ekzosoma transport vesicleBiologichnij proces receptor oposeredkovanij endocitoz cellular response to folic acid neural crest cell migration involved in heart formation axon regeneration COPII vesicle coating endoplasmic reticulum to Golgi vesicle mediated transport heart looping cardiac neural crest cell migration involved in outflow tract morphogenesis pharyngeal arch artery morphogenesis folic acid metabolic process regulation of transforming growth factor beta receptor signaling pathway response to axon injury regulation of canonical Wnt signaling pathway anterior neural tube closure folic acid transport GO 0015915 transport folate import across plasma membraneDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2348 14275Ensembl ENSG00000110195 ENSMUSG00000001827UniProt P15328 P35846RefSeq mRNK NM 016730 NM 000802 NM 016724 NM 016725 NM 016729NM 001252552 NM 001252553 NM 001252554 NM 008034RefSeq bilok NP 000793 NP 057936 NP 057937 NP 057941NP 001239481 NP 001239482 NP 001239483 NP 032060Lokus UCSC Hr 11 72 19 72 2 MbHr 7 101 51 101 52 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPE DKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHF IQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSY TCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVS NYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLAL MLLWLLS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do receptoriv Zadiyanij u takomu biologichnomu procesi yak transport Lokalizovanij u klitinnij membrani membrani citoplazmatichnih vezikulah endosomah Takozh sekretovanij nazovni ZahvoryuvannyaMutaciyi gena FOLR1 sho koduye receptor mozhut prizvoditi do rozvitku pri yakij rivni u spinnomozkovij ridini znachno znizheni nezvazhayuchi na normalni rivni u sirovatci krovi LiteraturaLacey S W Sanders J M Rothberg K G Anderson R G W Kamen B A 1989 Complementary DNA for the folate binding protein correctly predicts anchoring to the membrane by glycosyl phosphatidylinositol J Clin Invest 84 715 720 PMID 2527252 DOI 10 1172 JCI114220 Sadasivan E Cedeno M Rothenberg S P 1992 Genomic organization of the gene and a related pseudogene for a human folate binding protein Biochim Biophys Acta 1131 91 94 PMID 1581364 DOI 10 1016 0167 4781 92 90103 7 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Yan W Ratnam M 1995 Preferred sites of glycosylphosphatidylinositol modification in folate receptors and constraints in the primary structure of the hydrophobic portion of the signal Biochemistry 34 14594 14600 PMID 7578066 DOI 10 1021 bi00044a039 Picariello G Ferranti P Mamone G Roepstorff P Addeo F 2008 Identification of N linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry Proteomics 8 3833 3847 PMID 18780401 DOI 10 1002 pmic 200701057 Elwood P C 1989 Molecular cloning and characterization of the human folate binding protein cDNA from placenta and malignant tissue culture KB cells J Biol Chem 264 14893 14901 PMID 2768245PrimitkiZahvoryuvannya genetichno pov yazani z FOLR1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3791 angl Procitovano 8 veresnya 2017 angl Arhiv originalu za 19 veresnya 2017 Procitovano 8 veresnya 2017 Pope S Artuch R Heales S Rahman S Cerebral folate deficiency Analytical tests and differential diagnosis angl en journal 2019 March DOI 10 1002 jimd 12092 PMID 30916789 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi