FCER2 (англ. Fc fragment of IgE receptor II) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 321 амінокислот, а молекулярна маса — 36 469.
FCER2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | FCER2, BLAST-2, CD23, CD23A, CLEC4J, FCE2, IGEBF, Fc fragment of IgE receptor II, FCErII, Fc epsilon receptor II | ||||||||||||||||
Зовнішні ІД | OMIM: 151445 MGI: 95497 HomoloGene: 1517 GeneCards: FCER2 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 19: 7.69 – 7.7 Mb | Хр. 8: 3.73 – 3.74 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MEEGQYSEIE | ELPRRRCCRR | GTQIVLLGLV | TAALWAGLLT | LLLLWHWDTT | ||||
QSLKQLEERA | ARNVSQVSKN | LESHHGDQMA | QKSQSTQISQ | ELEELRAEQQ | ||||
RLKSQDLELS | WNLNGLQADL | SSFKSQELNE | RNEASDLLER | LREEVTKLRM | ||||
ELQVSSGFVC | NTCPEKWINF | QRKCYYFGKG | TKQWVHARYA | CDDMEGQLVS | ||||
IHSPEEQDFL | TKHASHTGSW | IGLRNLDLKG | EFIWVDGSHV | DYSNWAPGEP | ||||
TSRSQGEDCV | MMRGSGRWND | AFCDRKLGAW | VCDRLATCTP | PASEGSAESM | ||||
GPDSRPDPDG | RLPTPSAPLH | S |
Кодований геном білок за функцією належить до рецепторів. Білок має сайт для зв'язування з іонами металів, іоном кальцію, лектинами, імуноглобуліном IgE. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Bajorath J., Aruffo A. (1996). Structure-based modeling of the ligand binding domain of the human cell surface receptor CD23 and comparison of two independently derived molecular models. Protein Sci. 5: 240—247. PMID 8745401 DOI:10.1002/pro.5560050207
- Wurzburg B.A., Tarchevskaya S.S., Jardetzky T.S. (2006). Structural changes in the lectin domain of CD23, the low-affinity IgE receptor, upon calcium binding. Structure. 14: 1049—1058. PMID 16765898 DOI:10.1016/j.str.2006.03.017
- Padlan E.A., Helm B.A. (1993). Modeling of the lectin-homology domains of the human and murine low-affinity Fc epsilon receptor (Fc epsilon RII/CD23). Receptor. 3: 325—341. PMID 8142907
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 5 квітня 2016. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 29 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
FCER2 angl Fc fragment of IgE receptor II bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 321 aminokislot a molekulyarna masa 36 469 FCER2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB4KI1 1T8C 1T8D 2H2R 2H2T 4EZM 4G96 4G9A 4GI0 4GJ0 4GJX 4GK1 4GKO 4J6J 4J6K 4J6L 4J6M 4J6N 4J6P 4J6QIdentifikatoriSimvoliFCER2 BLAST 2 CD23 CD23A CLEC4J FCE2 IGEBF Fc fragment of IgE receptor II FCErII Fc epsilon receptor IIZovnishni ID OMIM 151445 MGI 95497 HomoloGene 1517 GeneCards FCER2Ontologiya genaMolekulyarna funkciya IgE binding integrin binding GO 0001948 GO 0016582 protein binding zv yazuvannya z ionom metalu carbohydrate bindingKlitinna komponenta integral component of membrane extracellular region klitinna membrana integral component of plasma membrane ekzosoma external side of plasma membrane membranaBiologichnij proces Signalnij shlyah Notch positive regulation of humoral immune response mediated by circulating immunoglobulin positive regulation of nitric oxide synthase activity positive regulation of killing of cells of other organism positive regulation of nitric oxide synthase biosynthetic process cytokine mediated signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2208 14128Ensembl ENSG00000104921 ENSMUSG00000005540UniProt P06734 P20693RefSeq mRNK NM 001207019 NM 001220500 NM 002002NM 001253737 NM 001253739 NM 001253743 NM 001253745 NM 001253746NM 001253747 NM 013517RefSeq bilok NP 001193948 NP 001207429 NP 001993NP 001240666 NP 001240668 NP 001240672 NP 001240674 NP 001240675NP 001240676 NP 038545Lokus UCSC Hr 19 7 69 7 7 MbHr 8 3 73 3 74 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHSA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do receptoriv Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom kalciyu lektinami imunoglobulinom IgE Lokalizovanij u klitinnij membrani membrani Takozh sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Bajorath J Aruffo A 1996 Structure based modeling of the ligand binding domain of the human cell surface receptor CD23 and comparison of two independently derived molecular models Protein Sci 5 240 247 PMID 8745401 DOI 10 1002 pro 5560050207 Wurzburg B A Tarchevskaya S S Jardetzky T S 2006 Structural changes in the lectin domain of CD23 the low affinity IgE receptor upon calcium binding Structure 14 1049 1058 PMID 16765898 DOI 10 1016 j str 2006 03 017 Padlan E A Helm B A 1993 Modeling of the lectin homology domains of the human and murine low affinity Fc epsilon receptor Fc epsilon RII CD23 Receptor 3 325 341 PMID 8142907PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 5 kvitnya 2016 Procitovano 12 veresnya 2017 angl Arhiv originalu za 29 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi