FASLG (англ. Fas ligand) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 281 амінокислот, а молекулярна маса — 31 485.
FASLG | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | FASLG, ALPS1B, APT1LG1, APTL, CD178, CD95-L, CD95L, FASL, TNFSF6, TNLG1A, Fas ligand | ||||||||||||||||
Зовнішні ІД | OMIM: 134638 MGI: 99255 HomoloGene: 533 GeneCards: FASLG | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 172.66 – 172.67 Mb | Хр. 1: 161.61 – 161.62 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MQQPFNYPYP | QIYWVDSSAS | SPWAPPGTVL | PCPTSVPRRP | GQRRPPPPPP | ||||
PPPLPPPPPP | PPLPPLPLPP | LKKRGNHSTG | LCLLVMFFMV | LVALVGLGLG | ||||
MFQLFHLQKE | LAELRESTSQ | MHTASSLEKQ | IGHPSPPPEK | KELRKVAHLT | ||||
GKSNSRSMPL | EWEDTYGIVL | LSGVKYKKGG | LVINETGLYF | VYSKVYFRGQ | ||||
SCNNLPLSHK | VYMRNSKYPQ | DLVMMEGKMM | SYCTTGQMWA | RSSYLGAVFN | ||||
LTSADHLYVN | VSELSLVNFE | ESQTFFGLYK | L |
Кодований геном білок за функціями належить до репресорів, цитокінів. Задіяний у таких біологічних процесах як апоптоз, транскрипція, регуляція транскрипції. Локалізований у клітинній мембрані, ядрі, мембрані, цитоплазматичних везикулах, лізосомі. Також секретований назовні.
Література
- Alderson M. (1995). Fas ligand mediates activation-induced cell death in human T lymphocytes. J. Exp. Med. 181: 71—77. PMID 7528780 DOI:10.1084/jem.181.1.71
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Tanaka M., Itai T., Adachi M., Nagata S. (1998). Downregulation of Fas ligand by shedding. Nat. Med. 4: 31—36. PMID 9427603 DOI:10.1038/nm0198-031
- Voss M., Lettau M., Janssen O. (2009). Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening. BMC Immunol. 10: 53—53. PMID 19807924 DOI:10.1186/1471-2172-10-53
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:11936 (англ.) . Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 24 вересня 2017. Процитовано 25 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
FASLG angl Fas ligand bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 281 aminokislot a molekulyarna masa 31 485 FASLGNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB4MSVIdentifikatoriSimvoliFASLG ALPS1B APT1LG1 APTL CD178 CD95 L CD95L FASL TNFSF6 TNLG1A Fas ligandZovnishni ID OMIM 134638 MGI 99255 HomoloGene 533 GeneCards FASLGOntologiya genaMolekulyarna funkciya cytokine activity GO 0001948 GO 0016582 protein binding tumor necrosis factor receptor binding signaling receptor binding death receptor bindingKlitinna komponenta integral component of membrane membrana cytoplasmic vesicle lumen klitinna membrana integral component of plasma membrane cell surface lysosomal lumen caveola perinuclear region of cytoplasm membrane raft lizosoma ekzosoma GO 0016023 cytoplasmic vesicle klitinne yadro external side of plasma membrane extracellular region mizhklitinnij prostirBiologichnij proces T cell apoptotic process GO 0009373 regulation of transcription DNA templated cell cell signaling endosomal lumen acidification GO 1901227 negative regulation of transcription by RNA polymerase II retinal cell programmed cell death transcription DNA templated response to lipopolysaccharide positive regulation of neuron apoptotic process positive regulation of endothelial cell apoptotic process necroptotic signaling pathway GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid positive regulation of cell population proliferation positive regulation of apoptotic process positive regulation of I kappaB kinase NF kappaB signaling negative regulation of angiogenesis regulation of extrinsic apoptotic signaling pathway via death domain receptors cellular chloride ion homeostasis response to growth factor inflammatory cell apoptotic process positive regulation of epidermal growth factor receptor signaling pathway extrinsic apoptotic signaling pathway via death domain receptors GO 0072468 signalna transdukciya extrinsic apoptotic signaling pathway activation of cysteine type endopeptidase activity involved in apoptotic process GO 0060554 GO 0060555 Nekroptoz apoptotic signaling pathway negative regulation of extrinsic apoptotic signaling pathway via death domain receptors GO 0097285 apoptoz release of sequestered calcium ion into cytosol by endoplasmic reticulum regulation of signaling receptor activity cytokine mediated signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez356 14103Ensembl ENSG00000117560 ENSMUSG00000000817UniProt P48023 P41047RefSeq mRNK NM 001302746 NM 000639NM 001205243 NM 010177RefSeq bilok NP 000630 NP 001289675NP 001192172 NP 034307Lokus UCSC Hr 1 172 66 172 67 MbHr 1 161 61 161 62 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKLA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do represoriv citokiniv Zadiyanij u takih biologichnih procesah yak apoptoz transkripciya regulyaciya transkripciyi Lokalizovanij u klitinnij membrani yadri membrani citoplazmatichnih vezikulah lizosomi Takozh sekretovanij nazovni LiteraturaAlderson M 1995 Fas ligand mediates activation induced cell death in human T lymphocytes J Exp Med 181 71 77 PMID 7528780 DOI 10 1084 jem 181 1 71 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Tanaka M Itai T Adachi M Nagata S 1998 Downregulation of Fas ligand by shedding Nat Med 4 31 36 PMID 9427603 DOI 10 1038 nm0198 031 Voss M Lettau M Janssen O 2009 Identification of SH3 domain interaction partners of human FasL CD178 by phage display screening BMC Immunol 10 53 53 PMID 19807924 DOI 10 1186 1471 2172 10 53PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 11936 angl Procitovano 25 serpnya 2017 angl Arhiv originalu za 24 veresnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi