Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
EMP2 (англ. Epithelial membrane protein 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми. Довжина поліпептидного ланцюга білка становить 167 амінокислот, а молекулярна маса — 19 199.
| EMP2 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Ідентифікатори | |||||||||||||||||
| Символи | EMP2, NPHS10, XMP, epithelial membrane protein 2 | ||||||||||||||||
| Зовнішні ІД | OMIM: 602334 MGI: 1098726 HomoloGene: 1089 GeneCards: EMP2 | ||||||||||||||||
| Пов'язані генетичні захворювання | |||||||||||||||||
| розлад дефіциту уваги та гіперактивності | |||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
 | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 16: 10.53 – 10.58 Mb | Хр. 16: 10.1 – 10.13 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MLVLLAFIIA | FHITSAALLF | IATVDNAWWV | GDEFFADVWR | ICTNNTNCTV | ||||
| INDSFQEYST | LQAVQATMIL | STILCCIAFF | IFVLQLFRLK | QGERFVLTSI | ||||
| IQLMSCLCVM | IAASIYTDRR | EDIHDKNAKF | YPVTREGSYG | YSYILAWVAF | ||||
| ACTFISGMMY | LILRKRK |
Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані, апараті гольджі.
Література
- Taylor V., Suter U. (1996). Epithelial membrane protein-2 and epithelial membrane protein-3: two novel members of the peripheral myelin protein 22 gene family. Gene. 175: 115—120. PMID 8917086 DOI:10.1016/0378-1119(96)00134-5
- Ben-Porath I., Benvenisty N. (1996). Characterization of a tumor-associated gene, a member of a novel family of genes encoding membrane glycoproteins. Gene. 183: 69—75. PMID 8996089 DOI:10.1016/S0378-1119(96)00475-1
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Wilson H.L., Wilson S.A., Surprenant A., North R.A. (2002). Epithelial membrane proteins induce membrane blebbing and interact with the P2X7 receptor C terminus. J. Biol. Chem. 277: 34017—34023. PMID 12107182 DOI:10.1074/jbc.M205120200
- Wadehra M., Sulur G.G., Braun J., Gordon L.K., Goodglick L. (2003). Epithelial membrane protein-2 is expressed in discrete anatomical regions of the eye. Exp. Mol. Pathol. 74: 106—112. PMID 12710941 DOI:10.1016/S0014-4800(03)00009-1
Примітки
- Захворювання, генетично пов'язані з EMP2 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:3334 (англ.) . Архів оригіналу за 6 квітня 2016. Процитовано 11 вересня 2017.
- UniProt, P54851 (англ.) . Архів оригіналу за 9 квітня 2017. Процитовано 11 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до . |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
EMP2 angl Epithelial membrane protein 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 16 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 167 aminokislot a molekulyarna masa 19 199 EMP2IdentifikatoriSimvoliEMP2 NPHS10 XMP epithelial membrane protein 2Zovnishni ID OMIM 602334 MGI 1098726 HomoloGene 1089 GeneCards EMP2Pov yazani genetichni zahvoryuvannyarozlad deficitu uvagi ta giperaktivnosti Ontologiya genaMolekulyarna funkciya protein kinase binding kinase binding GO 0001948 GO 0016582 protein binding integrin bindingKlitinna komponenta caveola citoplazma kompleks Goldzhi Golgi membrane klitinne yadro apical part of cell apical plasma membrane membrana cell surface membrane raft klitinna membrana GO 0016023 cytoplasmic vesicle integral component of membrane gialoplazmaBiologichnij proces regulation of kinase activity smert klitini T cell mediated cytotoxicity regulation of glomerular filtration regulation of angiogenesis positive regulation of cell matrix adhesion cell matrix adhesion actin filament organization bleb assembly protein localization to plasma membrane early endosome to late endosome transport positive regulation of cell population proliferation regulation of cell matrix adhesion membrane raft assembly caveola assembly cell migration regulation of endothelial cell migration activation of protein kinase activity protein localization to cell surface actin mediated cell contraction positive regulation of integrin mediated signaling pathway regulation of vasculogenesis adgeziya klitin blood vessel endothelial cell migration proliferaciya embryo implantationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2013 13731Ensembl ENSG00000213853 ENSMUSG00000022505UniProt P54851 O88662RefSeq mRNK NM 001424NM 007929RefSeq bilok NP 001415NP 031955Lokus UCSC Hr 16 10 53 10 58 MbHr 16 10 1 10 13 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTV INDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSI IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF ACTFISGMMYLILRKRK A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Lokalizovanij u klitinnij membrani citoplazmi yadri membrani aparati goldzhi LiteraturaTaylor V Suter U 1996 Epithelial membrane protein 2 and epithelial membrane protein 3 two novel members of the peripheral myelin protein 22 gene family Gene 175 115 120 PMID 8917086 DOI 10 1016 0378 1119 96 00134 5 Ben Porath I Benvenisty N 1996 Characterization of a tumor associated gene a member of a novel family of genes encoding membrane glycoproteins Gene 183 69 75 PMID 8996089 DOI 10 1016 S0378 1119 96 00475 1 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Wilson H L Wilson S A Surprenant A North R A 2002 Epithelial membrane proteins induce membrane blebbing and interact with the P2X7 receptor C terminus J Biol Chem 277 34017 34023 PMID 12107182 DOI 10 1074 jbc M205120200 Wadehra M Sulur G G Braun J Gordon L K Goodglick L 2003 Epithelial membrane protein 2 is expressed in discrete anatomical regions of the eye Exp Mol Pathol 74 106 112 PMID 12710941 DOI 10 1016 S0014 4800 03 00009 1PrimitkiZahvoryuvannya genetichno pov yazani z EMP2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3334 angl Arhiv originalu za 6 kvitnya 2016 Procitovano 11 veresnya 2017 UniProt P54851 angl Arhiv originalu za 9 kvitnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 16 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij