E2F1 (англ. E2F transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. Довжина поліпептидного ланцюга білка становить 437 амінокислот, а молекулярна маса — 46 920.
E2F1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | E2F1, E2F-1, RBAP1, RBBP3, RBP3, E2F transcription factor 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 189971 MGI: 101941 HomoloGene: 3828 GeneCards: E2F1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 20: 33.68 – 33.69 Mb | Хр. 2: 154.4 – 154.41 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MALAGAPAGG | PCAPALEALL | GAGALRLLDS | SQIVIISAAQ | DASAPPAPTG | ||||
PAAPAAGPCD | PDLLLFATPQ | APRPTPSAPR | PALGRPPVKR | RLDLETDHQY | ||||
LAESSGPARG | RGRHPGKGVK | SPGEKSRYET | SLNLTTKRFL | ELLSHSADGV | ||||
VDLNWAAEVL | KVQKRRIYDI | TNVLEGIQLI | AKKSKNHIQW | LGSHTTVGVG | ||||
GRLEGLTQDL | RQLQESEQQL | DHLMNICTTQ | LRLLSEDTDS | QRLAYVTCQD | ||||
LRSIADPAEQ | MVMVIKAPPE | TQLQAVDSSE | NFQISLKSKQ | GPIDVFLCPE | ||||
ETVGGISPGK | TPSQEVTSEE | ENRATDSATI | VSPPPSSPPS | SLTTDPSQSL | ||||
LSLEQEPLLS | RMGSLRAPVD | EDRLSPLVAA | DSLLEHVRED | FSGLLPEEFI | ||||
SLSPPHEALD | YHFGLEEGEG | IRDLFDCDFG | DLTPLDF |
Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, транскрипція, регуляція транскрипції, клітинний цикл, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.
Література
- Neuman E., Sellers W.R.S., McNeil J.A., Lawrence J.B., Kaelin W.G. Jr. (1996). Structure and partial genomic sequence of the human E2F1 gene. Gene. 173: 163—169. PMID 8964493 DOI:10.1016/0378-1119(96)00184-9
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Johnson D.G., Ohtani K., Nevins J.R. (1994). Autoregulatory control of E2F1 expression in response to positive and negative regulators of cell cycle progression. Genes Dev. 8: 1514—1525. PMID 7958836 DOI:10.1101/gad.8.13.1514
- Helin K., Harlow E., Fattaey A. (1993). Inhibition of E2F-1 transactivation by direct binding of the retinoblastoma protein. Mol. Cell. Biol. 13: 6501—6508. PMID 8413249 DOI:10.1128/MCB.13.10.6501
- Dynlacht B.D., Flores O., Lees J.A., Harlow E. (1994). Differential regulation of E2F transactivation by cyclin/cdk2 complexes. Genes Dev. 8: 1772—1786. PMID 7958856 DOI:10.1101/gad.8.15.1772
- Xu M., Sheppard K.-A., Peng C.-Y., Yee A.S., Piwnica-Worms H. (1994). Cyclin A/CDK2 binds directly to E2F-1 and inhibits the DNA-binding activity of E2F-1/DP-1 by phosphorylation. Mol. Cell. Biol. 14: 8420—8431. PMID 7969176 DOI:10.1128/MCB.14.12.8420
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:3113 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
E2F1 angl E2F transcription factor 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 437 aminokislot a molekulyarna masa 46 920 E2F1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1H24 1O9K 2AZEIdentifikatoriSimvoliE2F1 E2F 1 RBAP1 RBBP3 RBP3 E2F transcription factor 1Zovnishni ID OMIM 189971 MGI 101941 HomoloGene 3828 GeneCards E2F1Ontologiya genaMolekulyarna funkciya DNA binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity transcription factor binding GO 0001948 GO 0016582 protein binding protein dimerization activity GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specific sequence specific DNA binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific protein kinase binding GO 0001158 cis regulatory region sequence specific DNA binding GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specificKlitinna komponenta citoplazma transcription regulator complex Rb E2F complex klitinne yadro mitohondriya nukleoplazma centrosoma GO 0009327 protein containing complex RNA polymerase II transcription regulator complexBiologichnij proces cellular response to nerve growth factor stimulus negative regulation of fat cell differentiation GO 0009373 regulation of transcription DNA templated lens fiber cell apoptotic process negative regulation of transcription involved in G1 S transition of mitotic cell cycle positive regulation of fibroblast proliferation negative regulation of DNA binding negative regulation of fat cell proliferation DNA damage checkpoint signaling cellular response to xenobiotic stimulus GO 1901227 negative regulation of transcription by RNA polymerase II transcription DNA templated regulation of cell cycle GO 0060469 GO 0009371 positive regulation of transcription DNA templated regulation of G1 S transition of mitotic cell cycle mRNA stabilization positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway GO 1901313 positive regulation of gene expression cellular response to fatty acid anoikis Spermatogenez intrinsic apoptotic signaling pathway in response to DNA damage intrinsic apoptotic signaling pathway by p53 class mediator klitinnij cikl forebrain development GO 0045996 negative regulation of transcription DNA templated cellular response to hypoxia GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II GO 0097285 apoptoz DNA damage response signal transduction by p53 class mediator resulting in cell cycle arrest regulation of transcription involved in G1 S transition of mitotic cell cycle positive regulation of apoptotic process negative regulation of G0 to G1 transition positive regulation of glial cell proliferationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1869 13555Ensembl ENSG00000101412 ENSMUSG00000027490UniProt Q01094 Q61501RefSeq mRNK NM 005225NM 007891 NM 001291105RefSeq bilok NP 005216NP 001278034 NP 031917Lokus UCSC Hr 20 33 68 33 69 MbHr 2 154 4 154 41 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTG PAAPAAGPCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQY LAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGV VDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVG GRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQD LRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSL LSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFI SLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz transkripciya regulyaciya transkripciyi klitinnij cikl acetilyuvannya Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri LiteraturaNeuman E Sellers W R S McNeil J A Lawrence J B Kaelin W G Jr 1996 Structure and partial genomic sequence of the human E2F1 gene Gene 173 163 169 PMID 8964493 DOI 10 1016 0378 1119 96 00184 9 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Johnson D G Ohtani K Nevins J R 1994 Autoregulatory control of E2F1 expression in response to positive and negative regulators of cell cycle progression Genes Dev 8 1514 1525 PMID 7958836 DOI 10 1101 gad 8 13 1514 Helin K Harlow E Fattaey A 1993 Inhibition of E2F 1 transactivation by direct binding of the retinoblastoma protein Mol Cell Biol 13 6501 6508 PMID 8413249 DOI 10 1128 MCB 13 10 6501 Dynlacht B D Flores O Lees J A Harlow E 1994 Differential regulation of E2F transactivation by cyclin cdk2 complexes Genes Dev 8 1772 1786 PMID 7958856 DOI 10 1101 gad 8 15 1772 Xu M Sheppard K A Peng C Y Yee A S Piwnica Worms H 1994 Cyclin A CDK2 binds directly to E2F 1 and inhibits the DNA binding activity of E2F 1 DP 1 by phosphorylation Mol Cell Biol 14 8420 8431 PMID 7969176 DOI 10 1128 MCB 14 12 8420PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3113 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 31 serpnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 20 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi