DEFB4A (англ. Defensin beta 4B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми. Довжина поліпептидного ланцюга білка становить 64 амінокислот, а молекулярна маса — 7 038.
DEFB4B | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | DEFB4B, DEFB4P, defensin beta 4B | ||||||||||||||||
Зовнішні ІД | HomoloGene: 122147 GeneCards: DEFB4B | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 8: 7.41 – 7.42 Mb | н/д | |||||||||||||||
PubMed search | н/д | ||||||||||||||||
Вікідані | |||||||||||||||||
|
Кодований геном білок за функціями належить до антибіотиків, . Секретується назовні.
Література
- Harder J., Bartels J.H., Christophers E., Schroeder J.-M. (1997). A peptide antibiotic from human skin. Nature. 387: 861—861. PMID 9202117 DOI:10.1038/43088
- Diamond G., Kaiser V., Rhodes J., Russell J.P., Bevins C.L. (2000). Transcriptional regulation of beta-defensin gene expression in tracheal epithelial cells. Infect. Immun. 68: 113—119. PMID 10603376 DOI:10.1128/IAI.68.1.113-119.2000
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Kluever E., Schulz A., Forssmann W.-G., Adermann K. (2002). Chemical synthesis of beta-defensins and LEAP-1/hepcidin. J. Pept. Res. 59: 241—248. PMID 12010514 DOI:10.1034/j.1399-3011.2002.00980.x
- Roehrl J., Yang D., Oppenheim J.J., Hehlgans T. (2010). Specific binding and chemotactic activity of mBD4 and its functional orthologue hBD2 to CCR6-expressing cells. J. Biol. Chem. 285: 7028—7034. PMID 20068036 DOI:10.1074/jbc.M109.091090
Примітки
- Human PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:2767 (англ.) . Архів оригіналу за 2 липня 2017. Процитовано 7 вересня 2017. [Архівовано 2017-07-02 у Wayback Machine.]
- UniProt, O15263 (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 7 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до . |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
DEFB4A angl Defensin beta 4B bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 8 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 64 aminokislot a molekulyarna masa 7 038 DEFB4BNayavni strukturiPDBPoshuk dlya lyudej PDBe RCSB Spisok kodiv PDB1E4Q 1FD3 1FD4 1FQQIdentifikatoriSimvoliDEFB4B DEFB4P defensin beta 4BZovnishni ID HomoloGene 122147 GeneCards DEFB4BOntologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding CCR6 chemokine receptor binding chemoattractant activityKlitinna komponenta Golgi lumen extracellular region mizhklitinnij prostir vnutrishnoklitinnijBiologichnij proces G protein coupled receptor signaling pathway defense response GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid hemotaksis GO 0051636 defense response to Gram negative bacterium defense response to bacterium GO 0051637 defense response to Gram positive bacterium antimicrobial humoral response antimicrobial humoral immune response mediated by antimicrobial peptide positive chemotaxis cell chemotaxisDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez100289462 n dEnsembl ENSG00000177257 ENSG00000275444 ENSG00000285433 n dUniProt O15263 n dRefSeq mRNK NM 001205266n dRefSeq bilok NP 001192195 NP 004933n dLokus UCSC Hr 8 7 41 7 42 Mbn dPubMed search n dVikidaniDiv Red dlya lyudej Poslidovnist aminokislot1020304050 MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQI GTCGLPGTKCCKKP A Alanin C Cisteyin D Asparaginova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do antibiotikiv Sekretuyetsya nazovni LiteraturaHarder J Bartels J H Christophers E Schroeder J M 1997 A peptide antibiotic from human skin Nature 387 861 861 PMID 9202117 DOI 10 1038 43088 Diamond G Kaiser V Rhodes J Russell J P Bevins C L 2000 Transcriptional regulation of beta defensin gene expression in tracheal epithelial cells Infect Immun 68 113 119 PMID 10603376 DOI 10 1128 IAI 68 1 113 119 2000 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kluever E Schulz A Forssmann W G Adermann K 2002 Chemical synthesis of beta defensins and LEAP 1 hepcidin J Pept Res 59 241 248 PMID 12010514 DOI 10 1034 j 1399 3011 2002 00980 x Roehrl J Yang D Oppenheim J J Hehlgans T 2010 Specific binding and chemotactic activity of mBD4 and its functional orthologue hBD2 to CCR6 expressing cells J Biol Chem 285 7028 7034 PMID 20068036 DOI 10 1074 jbc M109 091090PrimitkiHuman PubMed Reference HUGO Gene Nomenclature Commitee HGNC 2767 angl Arhiv originalu za 2 lipnya 2017 Procitovano 7 veresnya 2017 Arhivovano 2017 07 02 u Wayback Machine UniProt O15263 angl Arhiv originalu za 8 serpnya 2017 Procitovano 7 veresnya 2017 Div takozhHromosoma 8 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij