CXCL10 (англ. C-X-C motif chemokine ligand 10) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. Довжина поліпептидного ланцюга білка становить 98 амінокислот, а молекулярна маса — 10 881.
CXCL10 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CXCL10, C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1, C-X-C motif chemokine ligand 10, C-X-C motif chemokine 10 | ||||||||||||||||
Зовнішні ІД | OMIM: 147310 MGI: 1352450 HomoloGene: 1203 GeneCards: CXCL10 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 4: 76.02 – 76.02 Mb | Хр. 5: 92.49 – 92.5 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах як запальна відповідь, хемотаксис. Секретований назовні.
Література
- Luster A.D., Unkeless J.C., Ravetch J.V. (1985). Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins. Nature. 315: 672—676. PMID 3925348 DOI:10.1038/315672a0
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Booth V., Keizer D.W., Kamphuis M.B., Clark-Lewis I., Sykes B.D. (2002). The CXCR3 binding chemokine IP-10/CXCL10: structure and receptor interactions. Biochemistry. 41: 10418—10425. PMID 12173928 DOI:10.1021/bi026020q
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:10637 (англ.) . Процитовано 30 серпня 2017.
- (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 30 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CXCL10 angl C X C motif chemokine ligand 10 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 4 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 98 aminokislot a molekulyarna masa 10 881 CXCL10Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1O80 1LV9 1O7Y 1O7ZIdentifikatoriSimvoliCXCL10 C7 IFI10 INP10 IP 10 SCYB10 crg 2 gIP 10 mob 1 C X C motif chemokine ligand 10 C X C motif chemokine 10Zovnishni ID OMIM 147310 MGI 1352450 HomoloGene 1203 GeneCards CXCL10Ontologiya genaMolekulyarna funkciya cytokine activity heparin binding CXCR3 chemokine receptor binding chemokine activity GO 0001948 GO 0016582 protein binding cAMP dependent protein kinase regulator activity signaling receptor binding chemoattractant activityKlitinna komponenta extracellular region external side of plasma membrane mizhklitinnij prostir vnutrishnoklitinnijBiologichnij proces regulation of endothelial tube morphogenesis negative regulation of myoblast differentiation cellular response to heat response to vitamin D positive regulation of cell migration T cell chemotaxis chemokine mediated signaling pathway cell cell signaling response to virus muscle organ development positive regulation of monocyte chemotaxis positive regulation of release of sequestered calcium ion into cytosol endothelial cell activation positive regulation of cAMP mediated signaling regulation of T cell chemotaxis krovoobig hemotaksis positive regulation of leukocyte chemotaxis cell surface receptor signaling pathway response to lipopolysaccharide negative regulation of myoblast fusion defense response to virus regulation of cell population proliferation GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid positive regulation of cell population proliferation response to auditory stimulus negative regulation of angiogenesis response to cold cellular response to lipopolysaccharide response to gamma radiation positive regulation of T cell migration GO 0072468 signalna transdukciya GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II regulation of protein kinase activity defense response inflammatory response antimicrobial humoral immune response mediated by antimicrobial peptide regulation of signaling receptor activity G protein coupled receptor signaling pathway cytokine mediated signaling pathway adenylate cyclase activating G protein coupled receptor signaling pathway response to bacterium neutrophil chemotaxis leukocyte chemotaxis positive chemotaxis regulation of apoptotic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3627 15945Ensembl ENSG00000169245 ENSMUSG00000034855UniProt P02778 P17515RefSeq mRNK NM 001565NM 021274RefSeq bilok NP 001556NP 067249Lokus UCSC Hr 4 76 02 76 02 MbHr 5 92 49 92 5 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEI IPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP A Alanin C Cisteyin E Glutaminova kislota F Fenilalanin G Glicin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Kodovanij genom bilok za funkciyeyu nalezhit do citokiniv Zadiyanij u takih biologichnih procesah yak zapalna vidpovid hemotaksis Sekretovanij nazovni LiteraturaLuster A D Unkeless J C Ravetch J V 1985 Gamma interferon transcriptionally regulates an early response gene containing homology to platelet proteins Nature 315 672 676 PMID 3925348 DOI 10 1038 315672a0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Booth V Keizer D W Kamphuis M B Clark Lewis I Sykes B D 2002 The CXCR3 binding chemokine IP 10 CXCL10 structure and receptor interactions Biochemistry 41 10418 10425 PMID 12173928 DOI 10 1021 bi026020qPrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10637 angl Procitovano 30 serpnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 30 serpnya 2017 Div takozhHromosoma 4 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi