Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
CRYGC (англ. Crystallin gamma C) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 174 амінокислот, а молекулярна маса — 20 879.
| CRYGC | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | CRYGC, CCL, CRYG3, CTRCT2, crystallin gamma C | ||||||||||||||||
| Зовнішні ІД | OMIM: 123680 MGI: 88523 HomoloGene: 36281 GeneCards: CRYGC | ||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
 | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 2: 208.13 – 208.13 Mb | Хр. 1: 65.11 – 65.11 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MGKITFYEDR | AFQGRSYETT | TDCPNLQPYF | SRCNSIRVES | GCWMLYERPN | ||||
| YQGQQYLLRR | GEYPDYQQWM | GLSDSIRSCC | LIPQTVSHRL | RLYEREDHKG | ||||
| LMMELSEDCP | SIQDRFHLSE | IRSLHVLEGC | WVLYELPNYR | GRQYLLRPQE | ||||
| YRRCQDWGAM | DAKAGSLRRV | VDLY |
Задіяний у такому біологічному процесі як поліморфізм.
Література
- den Dunnen J.T., Moormann R.J.M., Cremers F.P.M., Schoenmakers J.G.G. (1985). Two human gamma-crystallin genes are linked and riddled with Alu-repeats. Gene. 38: 197—204. PMID 4065573 DOI:10.1016/0378-1119(85)90218-5
- Meakin S.O., Breitman M.L., Tsui L.-C. (1985). Structural and evolutionary relationships among five members of the human gamma-crystallin gene family. Mol. Cell. Biol. 5: 1408—1414. PMID 4033658 DOI:10.1128/MCB.5.6.1408
- den Dunnen J.T., van Neck J.W., Cremers F.P.M., Lubsen N.H., Schoenmakers J.G.G. (1989). Nucleotide sequence of the rat gamma-crystallin gene region and comparison with an orthologous human region. Gene. 78: 201—213. PMID 2777080 DOI:10.1016/0378-1119(89)90223-0
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Lapko V.N., Smith D.L., Smith J.B. (2003). Methylation and carbamylation of human gamma-crystallins. Protein Sci. 12: 1762—1774. PMID 12876325 DOI:10.1110/ps.0305403
- Salim A., Zaidi Z.H. (2003). Homology models of human gamma-crystallins: structural study of the extensive charge network in gamma-crystallins. Biochem. Biophys. Res. Commun. 300: 624—630. PMID 12507494 DOI:10.1016/S0006-291X(02)02895-4
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:2410 (англ.) . Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 21 жовтня 2017. Процитовано 28 серпня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CRYGC angl Crystallin gamma C bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 174 aminokislot a molekulyarna masa 20 879 CRYGCNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2NBRIdentifikatoriSimvoliCRYGC CCL CRYG3 CTRCT2 crystallin gamma CZovnishni ID OMIM 123680 MGI 88523 HomoloGene 36281 GeneCards CRYGCOntologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding structural constituent of eye lensKlitinna komponenta citoplazma klitinne yadroBiologichnij proces zir lens development in camera type eyeDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1420 12966Ensembl ENSG00000163254 ENSG00000285011 ENSMUSG00000025952UniProt P07315 Q61597RefSeq mRNK NM 020989NM 001082573 NM 007775RefSeq bilok NP 066269NP 001076042 NP 031801Lokus UCSC Hr 2 208 13 208 13 MbHr 1 65 11 65 11 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPN YQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKG LMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQE YRRCQDWGAMDAKAGSLRRVVDLY A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takomu biologichnomu procesi yak polimorfizm Literaturaden Dunnen J T Moormann R J M Cremers F P M Schoenmakers J G G 1985 Two human gamma crystallin genes are linked and riddled with Alu repeats Gene 38 197 204 PMID 4065573 DOI 10 1016 0378 1119 85 90218 5 Meakin S O Breitman M L Tsui L C 1985 Structural and evolutionary relationships among five members of the human gamma crystallin gene family Mol Cell Biol 5 1408 1414 PMID 4033658 DOI 10 1128 MCB 5 6 1408 den Dunnen J T van Neck J W Cremers F P M Lubsen N H Schoenmakers J G G 1989 Nucleotide sequence of the rat gamma crystallin gene region and comparison with an orthologous human region Gene 78 201 213 PMID 2777080 DOI 10 1016 0378 1119 89 90223 0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Lapko V N Smith D L Smith J B 2003 Methylation and carbamylation of human gamma crystallins Protein Sci 12 1762 1774 PMID 12876325 DOI 10 1110 ps 0305403 Salim A Zaidi Z H 2003 Homology models of human gamma crystallins structural study of the extensive charge network in gamma crystallins Biochem Biophys Res Commun 300 624 630 PMID 12507494 DOI 10 1016 S0006 291X 02 02895 4PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 2410 angl Procitovano 28 serpnya 2017 angl Arhiv originalu za 21 zhovtnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi