Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CGA англ Glycoprotein hormones alpha polypeptide білок який кодується однойменним геном розташованим у людей на коротком

CGA (ген)

CGA (ген)

CGA (англ. Glycoprotein hormones, alpha polypeptide) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 116 амінокислот, а молекулярна маса — 13 075.

CGA
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CGA, CG-ALPHA, FSHA, GPHA1, GPHa, HCG, LHA, TSHA, Chorionic gonadotropin alpha, glycoprotein hormones, alpha polypeptide, Alpha subunit of glycoprotein hormones, GPA1
Зовнішні ІД OMIM: 118850 MGI: 88390 HomoloGene: 587 GeneCards: CGA
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
1081
12640
Ensembl
ENSG00000135346
ENSMUSG00000028298
UniProt
P01215
P01216
RefSeq (мРНК)
NM_001252383
NM_000735
NM_009889
RefSeq (білок)
NP_000726
NP_001239312
NP_034019
Локус (UCSC) Хр. 6: 87.09 – 87.1 Mb Хр. 4: 34.89 – 34.91 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPIL
QCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKV
ENHTACHCSTCYYHKS

Кодований геном білок за функцією належить до гормонів. Секретований назовні.

Література

  • Fiddes J.C., Goodman H.M. (1979). Isolation, cloning and sequence analysis of the cDNA for the alpha-subunit of human chorionic gonadotropin. Nature. 281: 351—356. PMID 481597 DOI:10.1038/281351a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Sairam M.R., Papkoff H., Li C.H. (1972). Human pituitary interstitial cell stimulating hormone: primary structure of the alpha-subunit. Biochem. Biophys. Res. Commun. 48: 530—537. PMID 5065401 DOI:10.1016/0006-291X(72)90380-4
  • Shome B., Parlow A.F. (1974). Human follicle stimulating hormone (hFSH): first proposal for the amino acid sequence of the alpha-subunit (hFSHa) and first demonstration of its identity with the alpha-subunit of human luteinizing hormone (hLHa). J. Clin. Endocrinol. Metab. 39: 199—202. PMID 4835135 DOI:10.1210/jcem-39-1-199
  • Fujiki Y., Rathnam P., Saxena B.B. (1980). Studies on the disulfide bonds in human pituitary follicle-stimulating hormone. Biochim. Biophys. Acta. 624: 428—435. PMID 6774759 DOI:10.1016/0005-2795(80)90084-7
  • Weisshaar G., Hiyama J., Renwick A.G.C., Nimtz M. (1991). NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin. Eur. J. Biochem. 195: 257—268. PMID 1991473 DOI:10.1111/j.1432-1033.1991.tb15702.x

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:1885 (англ.) . Процитовано 6 вересня 2017.
  4. (англ.) . Архів оригіналу за 26 серпня 2017. Процитовано 6 вересня 2017.

Див. також


image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CGA angl Glycoprotein hormones alpha polypeptide bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 116 aminokislot a molekulyarna masa 13 075 CGANayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1DZ7 1E9J 1FL7 1HCN 1HD4 1HRP 1QFW 1XWD 4AY9 4MQWIdentifikatoriSimvoliCGA CG ALPHA FSHA GPHA1 GPHa HCG LHA TSHA Chorionic gonadotropin alpha glycoprotein hormones alpha polypeptide Alpha subunit of glycoprotein hormones GPA1Zovnishni ID OMIM 118850 MGI 88390 HomoloGene 587 GeneCards CGAOntologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding hormone activity follicle stimulating hormone activityKlitinna komponenta Golgi lumen extracellular region mizhklitinnij prostir follicle stimulating hormone complexBiologichnij proces cell cell signaling peptide hormone processing positive regulation of cell population proliferation GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II GO 0072468 signalna transdukciya positive regulation of cell migration GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II regulation of signaling receptor activity G protein coupled receptor signaling pathway positive regulation of steroid biosynthetic process thyroid hormone generationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1081 12640Ensembl ENSG00000135346 ENSMUSG00000028298UniProt P01215 P01216RefSeq mRNK NM 001252383 NM 000735NM 009889RefSeq bilok NP 000726 NP 001239312NP 034019Lokus UCSC Hr 6 87 09 87 1 MbHr 4 34 89 34 91 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do gormoniv Sekretovanij nazovni LiteraturaFiddes J C Goodman H M 1979 Isolation cloning and sequence analysis of the cDNA for the alpha subunit of human chorionic gonadotropin Nature 281 351 356 PMID 481597 DOI 10 1038 281351a0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Sairam M R Papkoff H Li C H 1972 Human pituitary interstitial cell stimulating hormone primary structure of the alpha subunit Biochem Biophys Res Commun 48 530 537 PMID 5065401 DOI 10 1016 0006 291X 72 90380 4 Shome B Parlow A F 1974 Human follicle stimulating hormone hFSH first proposal for the amino acid sequence of the alpha subunit hFSHa and first demonstration of its identity with the alpha subunit of human luteinizing hormone hLHa J Clin Endocrinol Metab 39 199 202 PMID 4835135 DOI 10 1210 jcem 39 1 199 Fujiki Y Rathnam P Saxena B B 1980 Studies on the disulfide bonds in human pituitary follicle stimulating hormone Biochim Biophys Acta 624 428 435 PMID 6774759 DOI 10 1016 0005 2795 80 90084 7 Weisshaar G Hiyama J Renwick A G C Nimtz M 1991 NMR investigations of the N linked oligosaccharides at individual glycosylation sites of human lutropin Eur J Biochem 195 257 268 PMID 1991473 DOI 10 1111 j 1432 1033 1991 tb15702 xPrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1885 angl Procitovano 6 veresnya 2017 angl Arhiv originalu za 26 serpnya 2017 Procitovano 6 veresnya 2017 Div takozhHromosoma 6 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ