Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
CDKN1B (англ. Cyclin dependent kinase inhibitor 1B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 198 амінокислот, а молекулярна маса — 22 073.
| CDKN1B | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | CDKN1B, CDKN4, KIP1, MEN1B, MEN4, P27KIP1, cyclin-dependent kinase inhibitor 1B, cyclin dependent kinase inhibitor 1B | ||||||||||||||||
| Зовнішні ІД | OMIM: 600778 MGI: 104565 HomoloGene: 2999 GeneCards: CDKN1B | ||||||||||||||||
| Пов'язані генетичні захворювання | |||||||||||||||||
| multiple endocrine neoplasia type 4 | |||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
 | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 12: 12.69 – 12.72 Mb | Хр. 6: 134.9 – 134.9 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MSNVRVSNGS | PSLERMDARQ | AEHPKPSACR | NLFGPVDHEE | LTRDLEKHCR | ||||
| DMEEASQRKW | NFDFQNHKPL | EGKYEWQEVE | KGSLPEFYYR | PPRPPKGACK | ||||
| VPAQESQDVS | GSRPAAPLIG | APANSEDTHL | VDPKTDPSDS | QTGLAEQCAG | ||||
| IRKRPATDDS | STQNKRANRT | EENVSDGSPN | AGSVEQTPKK | PGLRRRQT |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як клітинний цикл. Локалізований у цитоплазмі, ядрі, ендосомах.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Ishida N., Kitagawa M., Hatakeyama S., Nakayama K. (2000). Phosphorylation at serine 10, a major phosphorylation site of p27(Kip1), increases its protein stability. J. Biol. Chem. 275: 25146—25154. PMID 10831586 DOI:10.1074/jbc.M001144200
- Fujita N., Sato S., Katayama K., Tsuruo T. (2002). Akt-dependent phosphorylation of p27Kip1 promotes binding to 14-3-3 and cytoplasmic localization. J. Biol. Chem. 277: 28706—28713. PMID 12042314 DOI:10.1074/jbc.M203668200
- Fujita N., Sato S., Tsuruo T. (2003). Phosphorylation of p27Kip1 at threonine 198 by p90 ribosomal protein S6 kinases promotes its binding to 14-3-3 and cytoplasmic localization. J. Biol. Chem. 278: 49254—49260. PMID 14504289 DOI:10.1074/jbc.M306614200
- Porter L.A., Kong-Beltran M., Donoghue D.J. (2003). Spy1 interacts with p27Kip1 to allow G1/S progression. Mol. Biol. Cell. 14: 3664—3674. PMID 12972555 DOI:10.1091/mbc.E02-12-0820
- Aleem E., Kiyokawa H., Kaldis P. (2005). Cdc2-cyclin E complexes regulate the G1/S phase transition. Nat. Cell Biol. 7: 831—836. PMID 16007079 DOI:10.1038/ncb1284
Примітки
- Захворювання, генетично пов'язані з CDKN1B переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1785 (англ.) . Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 25 вересня 2017. Процитовано 11 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CDKN1B angl Cyclin dependent kinase inhibitor 1B bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 198 aminokislot a molekulyarna masa 22 073 CDKN1BNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2AST 1H27 1JSUIdentifikatoriSimvoliCDKN1B CDKN4 KIP1 MEN1B MEN4 P27KIP1 cyclin dependent kinase inhibitor 1B cyclin dependent kinase inhibitor 1BZovnishni ID OMIM 600778 MGI 104565 HomoloGene 2999 GeneCards CDKN1BPov yazani genetichni zahvoryuvannyamultiple endocrine neoplasia type 4 Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding protein phosphatase binding cyclin dependent protein serine threonine kinase activity protein kinase inhibitor activity protein kinase binding cyclin binding cyclin dependent protein serine threonine kinase inhibitor activity Hsp70 protein binding GO 0032403 protein containing complex binding chaperone bindingKlitinna komponenta citoplazma gialoplazma endosoma nukleoplazma Cul4A RING E3 ubiquitin ligase complex klitinne yadro vnutrishnoklitinna membranna organela GO 0009327 protein containing complexBiologichnij proces Signalnij shlyah Notch regulation of cyclin dependent protein serine threonine kinase activity DNA damage response signal transduction by p53 class mediator resulting in cell cycle arrest response to estradiol positive regulation of cell death response to hypoxia response to amino acid response to cadmium ion GO 1903364 positive regulation of protein catabolic process GO 1904578 response to organic cyclic compound cellular response to lithium ion GO 1904579 cellular response to organic cyclic compound response to peptide hormone smert klitini negative regulation of apoptotic process sluh response to glucose potassium ion transport regulation of cell population proliferation negative regulation of cell growth negative regulation of epithelial cell proliferation involved in prostate gland development positive regulation of cell population proliferation positive regulation of cyclin dependent protein serine threonine kinase activity negative regulation of epithelial cell proliferation positive regulation of microtubule polymerization inner ear development GO 1904577 cellular response to antibiotic klitinnij cikl negative regulation of phosphorylation GO 0045996 negative regulation of transcription DNA templated autophagic cell death negative regulation of cell population proliferation negative regulation of mitotic cell cycle negative regulation of kinase activity positive regulation of cell cycle negative regulation of vascular associated smooth muscle cell proliferation placenta development regulation of exit from mitosis regulation of lens fiber cell differentiation negative regulation of cyclin dependent protein kinase activity negative regulation of cell cycle negative regulation of cyclin dependent protein serine threonine kinase activity G1 S transition of mitotic cell cycleDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1027 12576Ensembl ENSG00000111276 ENSMUSG00000003031UniProt P46527 P46414RefSeq mRNK NM 004064NM 009875RefSeq bilok NP 004055NP 034005Lokus UCSC Hr 12 12 69 12 72 MbHr 6 134 9 134 9 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCR DMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACK VPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAG IRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak klitinnij cikl Lokalizovanij u citoplazmi yadri endosomah LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Ishida N Kitagawa M Hatakeyama S Nakayama K 2000 Phosphorylation at serine 10 a major phosphorylation site of p27 Kip1 increases its protein stability J Biol Chem 275 25146 25154 PMID 10831586 DOI 10 1074 jbc M001144200 Fujita N Sato S Katayama K Tsuruo T 2002 Akt dependent phosphorylation of p27Kip1 promotes binding to 14 3 3 and cytoplasmic localization J Biol Chem 277 28706 28713 PMID 12042314 DOI 10 1074 jbc M203668200 Fujita N Sato S Tsuruo T 2003 Phosphorylation of p27Kip1 at threonine 198 by p90 ribosomal protein S6 kinases promotes its binding to 14 3 3 and cytoplasmic localization J Biol Chem 278 49254 49260 PMID 14504289 DOI 10 1074 jbc M306614200 Porter L A Kong Beltran M Donoghue D J 2003 Spy1 interacts with p27Kip1 to allow G1 S progression Mol Biol Cell 14 3664 3674 PMID 12972555 DOI 10 1091 mbc E02 12 0820 Aleem E Kiyokawa H Kaldis P 2005 Cdc2 cyclin E complexes regulate the G1 S phase transition Nat Cell Biol 7 831 836 PMID 16007079 DOI 10 1038 ncb1284PrimitkiZahvoryuvannya genetichno pov yazani z CDKN1B pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1785 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 25 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 12 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi