Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CDKN1A англ Cyclin dependent kinase inhibitor 1A білок який кодується однойменним геном розташованим у людей на коротком

CDKN1A

CDKN1A

CDKN1A (англ. Cyclin dependent kinase inhibitor 1A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 164 амінокислот, а молекулярна маса — 18 119.

CDKN1A
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CDKN1A, CAP20, CDKN1, CIP1, MDA-6, P21, SDI1, WAF1, p21CIP1, cyclin-dependent kinase inhibitor 1A, cyclin dependent kinase inhibitor 1A
Зовнішні ІД OMIM: 116899 MGI: 104556 HomoloGene: 333 GeneCards: CDKN1A
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
1026
12575
Ensembl
ENSG00000124762
ENSMUSG00000023067
UniProt
P38936
P39689
RefSeq (мРНК)
NM_078467
NM_000389
NM_001220777
NM_001220778
NM_001291549
NM_001111099
NM_007669
RefSeq (білок)
NP_001104569
NP_031695
Локус (UCSC) Хр. 6: 36.68 – 36.69 Mb Хр. 17: 29.31 – 29.32 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWN
FDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPA
LLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDF
YHSKRRLIFSKRKP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі.

Література

  • Harper J.W., Adami G.R., Wei N., Keyomarsi K., Elledge S.J. (1993). The p21 Cdk-interacting protein Cip1 is a potent inhibitor of G1 cyclin-dependent kinases. Cell. 75: 805—816. PMID 8242751 DOI:10.1016/0092-8674(93)90499-G
  • Noda A., Ning Y., Venable S.F., Pereira-Smith O.M., Smith J.R. (1994). Cloning of senescent cell-derived inhibitors of DNA synthesis using an expression screen. Exp. Cell Res. 211: 90—98. PMID 8125163 DOI:10.1006/excr.1994.1063
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Scott M.T., Morrice N., Ball K.L. (2000). Reversible phosphorylation at the C-terminal regulatory domain of p21(Waf1/Cip1) modulates proliferating cell nuclear antigen binding. J. Biol. Chem. 275: 11529—11537. PMID 10753973 DOI:10.1074/jbc.275.15.11529
  • Coulombe P., Rodier G., Bonneil E., Thibault P., Meloche S. (2004). N-Terminal ubiquitination of extracellular signal-regulated kinase 3 and p21 directs their degradation by the proteasome. Mol. Cell. Biol. 24: 6140—6150. PMID 15226418 DOI:10.1128/MCB.24.14.6140-6150.2004
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat. Biotechnol. 24: 1285—1292. PMID 16964243 DOI:10.1038/nbt1240

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 25 березня 2016. Процитовано 6 вересня 2017.
  4. (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 6 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CDKN1A angl Cyclin dependent kinase inhibitor 1A bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 164 aminokislot a molekulyarna masa 18 119 CDKN1ANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1AXC 2ZVV 2ZVW 4RJF 5E0UIdentifikatoriSimvoliCDKN1A CAP20 CDKN1 CIP1 MDA 6 P21 SDI1 WAF1 p21CIP1 cyclin dependent kinase inhibitor 1A cyclin dependent kinase inhibitor 1AZovnishni ID OMIM 116899 MGI 104556 HomoloGene 333 GeneCards CDKN1AOntologiya genaMolekulyarna funkciya zv yazuvannya z ionom metalu GO 0001948 GO 0016582 protein binding cyclin dependent protein serine threonine kinase inhibitor activity ubiquitin protein ligase binding cyclin binding cyclin dependent protein kinase activating kinase activity cyclin dependent protein serine threonine kinase activity protein kinase inhibitor activity protein kinase binding GO 0032403 protein containing complex bindingKlitinna komponenta citoplazma gialoplazma cyclin dependent protein kinase holoenzyme complex PCNA p21 complex perinuclear region of cytoplasm klitinne yadro nukleoplazma yaderce yaderni tilcya GO 0009327 protein containing complexBiologichnij proces cellular response to extracellular stimulus signal transduction by p53 class mediator intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator cellular response to heat regulation of cyclin dependent protein serine threonine kinase activity DNA damage response signal transduction by p53 class mediator resulting in cell cycle arrest positive regulation of cell death GO 1904578 response to organic cyclic compound negative regulation of cyclin dependent protein serine threonine kinase activity stress induced premature senescence positive regulation of fibroblast proliferation replicative senescence response to hyperoxia response to corticosterone cellular response to amino acid starvation positive regulation of programmed cell death negative regulation of apoptotic process response to glucocorticoid response to arsenic containing substance regulation of DNA biosynthetic process response to organic substance negative regulation of gene expression cellular response to DNA damage stimulus GO 1990376 negative regulation of G1 S transition of mitotic cell cycle regulation of cell cycle intrinsic apoptotic signaling pathway klitinne starinnya positive regulation of reactive oxygen species metabolic process cellular response to UV B G2 M transition of mitotic cell cycle positive regulation of B cell proliferation negative regulation of cell growth response to organonitrogen compound animal organ regeneration regulation of mitotic cell cycle intestinal epithelial cell maturation cellular response to ionizing radiation klitinnij cikl Ras protein signal transduction negative regulation of phosphorylation response to toxic substance response to UV response to X ray negative regulation of cell population proliferation protein stabilization positive regulation of cyclin dependent protein kinase activity GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II DNA damage response signal transduction by p53 class mediator resulting in transcription of p21 class mediator positive regulation of protein kinase activity cellular response to gamma radiation negative regulation of cyclin dependent protein kinase activity transcription initiation from RNA polymerase II promoter G1 S transition of mitotic cell cycle cytokine mediated signaling pathway negative regulation of vascular associated smooth muscle cell proliferationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1026 12575Ensembl ENSG00000124762 ENSMUSG00000023067UniProt P38936 P39689RefSeq mRNK NM 078467 NM 000389 NM 001220777 NM 001220778 NM 001291549NM 001111099 NM 007669RefSeq bilok NP 000380 NP 001207706 NP 001207707 NP 001278478 NP 510867NP 001361438 NP 001361439 NP 001361440 NP 001361441 NP 001361442NP 001104569 NP 031695Lokus UCSC Hr 6 36 68 36 69 MbHr 17 29 31 29 32 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWN FDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPA LLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDF YHSKRRLIFSKRKP A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinnij cikl acetilyuvannya Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku Lokalizovanij u citoplazmi yadri LiteraturaHarper J W Adami G R Wei N Keyomarsi K Elledge S J 1993 The p21 Cdk interacting protein Cip1 is a potent inhibitor of G1 cyclin dependent kinases Cell 75 805 816 PMID 8242751 DOI 10 1016 0092 8674 93 90499 G Noda A Ning Y Venable S F Pereira Smith O M Smith J R 1994 Cloning of senescent cell derived inhibitors of DNA synthesis using an expression screen Exp Cell Res 211 90 98 PMID 8125163 DOI 10 1006 excr 1994 1063 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Scott M T Morrice N Ball K L 2000 Reversible phosphorylation at the C terminal regulatory domain of p21 Waf1 Cip1 modulates proliferating cell nuclear antigen binding J Biol Chem 275 11529 11537 PMID 10753973 DOI 10 1074 jbc 275 15 11529 Coulombe P Rodier G Bonneil E Thibault P Meloche S 2004 N Terminal ubiquitination of extracellular signal regulated kinase 3 and p21 directs their degradation by the proteasome Mol Cell Biol 24 6140 6150 PMID 15226418 DOI 10 1128 MCB 24 14 6140 6150 2004 Beausoleil S A Villen J Gerber S A Rush J Gygi S P 2006 A probability based approach for high throughput protein phosphorylation analysis and site localization Nat Biotechnol 24 1285 1292 PMID 16964243 DOI 10 1038 nbt1240PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 25 bereznya 2016 Procitovano 6 veresnya 2017 angl Arhiv originalu za 31 serpnya 2017 Procitovano 6 veresnya 2017 Div takozhHromosoma 6 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ