CDK5R1 (англ. Cyclin dependent kinase 5 regulatory subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 307 амінокислот, а молекулярна маса — 34 060.
CDK5R1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CDK5R1, CDK5P35, CDK5R, NCK5A, p23, p25, p35, p35nck5a, cyclin-dependent kinase 5, regulatory subunit 1 (p35), cyclin dependent kinase 5 regulatory subunit 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 603460 MGI: 101764 HomoloGene: 31200 GeneCards: CDK5R1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 17: 32.49 – 32.49 Mb | Хр. 11: 80.37 – 80.37 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MGTVLSLSPS | YRKATLFEDG | AATVGHYTAV | QNSKNAKDKN | LKRHSIISVL | ||||
PWKRIVAVSA | KKKNSKKVQP | NSSYQNNITH | LNNENLKKSL | SCANLSTFAQ | ||||
PPPAQPPAPP | ASQLSGSQTG | GSSSVKKAPH | PAVTSAGTPK | RVIVQASTSE | ||||
LLRCLGEFLC | RRCYRLKHLS | PTDPVLWLRS | VDRSLLLQGW | QDQGFITPAN | ||||
VVFLYMLCRD | VISSEVGSDH | ELQAVLLTCL | YLSYSYMGNE | ISYPLKPFLV | ||||
ESCKEAFWDR | CLSVINLMSS | KMLQINADPH | YFTQVFSDLK | NESGQEDKKR | ||||
LLLGLDR |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як біологічні ритми. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані.
Література
- Tsai L.-H., Delalle I., Caviness V.S. Jr., Chae T., Harlow E. (1994). p35 is a neural-specific regulatory subunit of cyclin-dependent kinase 5. Nature. 371: 419—423. PMID 8090221 DOI:10.1038/371419a0
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Kerokoski P., Suuronen T., Salminen A., Soininen H., Pirttilae T. (2002). Influence of phosphorylation of p35, an activator of cyclin-dependent kinase 5 (cdk5), on the proteolysis of p35. Brain Res. Mol. Brain Res. 106: 50—56. PMID 12393264 DOI:10.1016/S0169-328X(02)00409-6
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1775 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 25 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CDK5R1 angl Cyclin dependent kinase 5 regulatory subunit 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 307 aminokislot a molekulyarna masa 34 060 CDK5R1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1H4L 1UNG 1UNH 1UNL 3O0GIdentifikatoriSimvoliCDK5R1 CDK5P35 CDK5R NCK5A p23 p25 p35 p35nck5a cyclin dependent kinase 5 regulatory subunit 1 p35 cyclin dependent kinase 5 regulatory subunit 1Zovnishni ID OMIM 603460 MGI 101764 HomoloGene 31200 GeneCards CDK5R1Ontologiya genaMolekulyarna funkciya protein kinase activity calcium ion binding ephrin receptor binding cadherin binding GO 0016534 cyclin dependent protein serine threonine kinase activator activity kinase activity GO 0001948 GO 0016582 protein binding protein kinase binding protein serine threonine kinase activator activity protease binding actin binding ionotropic glutamate receptor binding alpha tubulin binding beta tubulin binding actin filament binding protein kinase activator activityKlitinna komponenta citoplazma gialoplazma membrana GO 0097483 GO 0097481 postsinaptichne ushilnennya vnutrishnoklitinna membranna organela growth cone neuromuscular junction dendritic spine akson neuronal cell body dendrit nejrobiologiya protein kinase 5 complex perinuclear region of cytoplasm contractile fiber klitinne yadro nukleoplazma klitinna membrana mikrotrubochka neuron projection presynapseBiologichnij proces positive regulation of protein kinase activity regulation of neuron differentiation G protein coupled acetylcholine receptor signaling pathway regulation of cyclin dependent protein serine threonine kinase activity regulation of actin cytoskeleton organization embryo development ritmichnij proces ephrin receptor signaling pathway neuron cell cell adhesion regulation of microtubule cytoskeleton organization neuron migration cerebellum development positive regulation of protein serine threonine kinase activity positive regulation of neuron apoptotic process brain development ionotropic glutamate receptor signaling pathway layer formation in cerebral cortex GO 0035404 peptidyl serine phosphorylation neuron differentiation proliferaciya peptidyl threonine phosphorylation GO 0045996 negative regulation of transcription DNA templated neuron projection development cerebral cortex radially oriented cell migration axonal fasciculation hippocampus development negative regulation of axon extension regulation of dendritic spine morphogenesis regulation of macroautophagy superior olivary nucleus maturation positive regulation of protein targeting to membrane axon guidance regulation of signal transduction by p53 class mediator serine phosphorylation of STAT protein microtubule cytoskeleton organization embryo development ending in birth or egg hatching positive regulation of microtubule polymerization positive regulation of cyclin dependent protein serine threonine kinase activity regulation of synaptic vesicle cycle activation of protein kinase activityDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez8851 12569Ensembl ENSG00000176749 ENSMUSG00000048895UniProt Q15078 P61809RefSeq mRNK NM 003885NM 009871RefSeq bilok NP 003876NP 034001Lokus UCSC Hr 17 32 49 32 49 MbHr 11 80 37 80 37 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVL PWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQ PPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSE LLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPAN VVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLV ESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR LLLGLDR A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak biologichni ritmi Lokalizovanij u klitinnij membrani citoplazmi yadri membrani LiteraturaTsai L H Delalle I Caviness V S Jr Chae T Harlow E 1994 p35 is a neural specific regulatory subunit of cyclin dependent kinase 5 Nature 371 419 423 PMID 8090221 DOI 10 1038 371419a0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kerokoski P Suuronen T Salminen A Soininen H Pirttilae T 2002 Influence of phosphorylation of p35 an activator of cyclin dependent kinase 5 cdk5 on the proteolysis of p35 Brain Res Mol Brain Res 106 50 56 PMID 12393264 DOI 10 1016 S0169 328X 02 00409 6PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1775 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 25 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 17 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi