CCL4 (англ. C-C motif chemokine ligand 4 like 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 92 амінокислот, а молекулярна маса — 10 212.
CCL4L1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CCL4L1, AT744.2, CCL4L, LAG-1, LAG1, SCYA4L, SCYA4L1, MIP-1-beta, SCYA4L2, C-C motif chemokine ligand 4 like 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 603782 GeneCards: CCL4L1 | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | н/д | н/д | |||||||||||||||
PubMed search | н/д | ||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MKLCVTVLSL | LMLVAAFCSP | ALSAPMGSDP | PTACCFSYTA | RKLPRNFVVD | ||||
YYETSSLCSQ | PAVVFQTKRS | KQVCADPSES | WVQEYVYDLE | LN |
Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах, як запальна відповідь, хемотаксис. Секретований назовні.
Література
- Lipes M.A., Napolitano M., Jeang K.-T., Chang N.T., Leonard W.J. (1988). Identification, cloning, and characterization of an immune activation gene. Proc. Natl. Acad. Sci. U.S.A. 85: 9704—9708. PMID 2462251 DOI:10.1073/pnas.85.24.9704
- Chang H.C., Reinherz E.L. (1989). Isolation and characterization of a cDNA encoding a putative cytokine which is induced by stimulation via the CD2 structure on human T lymphocytes. Eur. J. Immunol. 19: 1045—1051. PMID 2568930 DOI:10.1002/eji.1830190614
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Guan E., Wang J., Roderiquez G., Norcross M.A. (2002). Natural truncation of the chemokine MIP-1beta/CCL4 affects receptor specificity but not anti-HIV-1 activity. J. Biol. Chem. 277: 32348—32352. PMID 12070155 DOI:10.1074/jbc.M203077200
- Menten P., Wuyts A., Van Damme J. (2002). Macrophage inflammatory protein-1. Cytokine Growth Factor Rev. 13: 455—481. PMID 12401480 DOI:10.1016/S1359-6101(02)00045-X
- Zipfel P.F., Balke J., Irving S.G., Kelly K., Siebenlist U. (1989). Mitogenic activation of human T cells induces two closely related genes which share structural similarities with a new family of secreted factors. J. Immunol. 142: 1582—1590. PMID 2521882
Примітки
- Human PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:10630 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 7 жовтня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CCL4 angl C C motif chemokine ligand 4 like 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 92 aminokislot a molekulyarna masa 10 212 CCL4L1Nayavni strukturiPDBPoshuk dlya lyudej PDBe RCSB Spisok kodiv PDB1HUM 1HUN 1JE4 2FFK 2FIN 2X6L 3TN2 4RALIdentifikatoriSimvoliCCL4L1 AT744 2 CCL4L LAG 1 LAG1 SCYA4L SCYA4L1 MIP 1 beta SCYA4L2 C C motif chemokine ligand 4 like 1Zovnishni ID OMIM 603782 GeneCards CCL4L1Ontologiya genaMolekulyarna funkciya chemokine activity cytokine activity GO 0001948 GO 0016582 protein binding CCR chemokine receptor binding CCR5 chemokine receptor binding CCR1 chemokine receptor binding identical protein bindingKlitinna komponenta extracellular region mizhklitinnij prostirBiologichnij proces lymphocyte chemotaxis chemokine mediated signaling pathway cellular response to tumor necrosis factor G protein coupled receptor signaling pathway GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity hemotaksis inflammatory response cellular response to interleukin 1 monocyte chemotaxis neutrophil chemotaxis GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid positive regulation of ERK1 and ERK2 cascade cellular response to interferon gamma regulation of signaling receptor activity eosinophil chemotaxis positive regulation of calcium mediated signaling positive regulation of natural killer cell chemotaxis cell cell signaling response to virus establishment or maintenance of cell polarity adgeziya klitin response to toxic substance GO 0072468 signalna transdukciya positive regulation of calcium ion transport cytokine mediated signaling pathwayDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez388372 n dEnsembl n d n dUniProt Q8NHW4 P13236 n dRefSeq mRNK NM 207007n dRefSeq bilok NP 996890 NP 002975n dLokus UCSC n dn dPubMed search n dVikidaniDiv Red dlya lyudej Poslidovnist aminokislot1020304050 MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVD YYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do citokiniv Zadiyanij u takih biologichnih procesah yak zapalna vidpovid hemotaksis Sekretovanij nazovni LiteraturaLipes M A Napolitano M Jeang K T Chang N T Leonard W J 1988 Identification cloning and characterization of an immune activation gene Proc Natl Acad Sci U S A 85 9704 9708 PMID 2462251 DOI 10 1073 pnas 85 24 9704 Chang H C Reinherz E L 1989 Isolation and characterization of a cDNA encoding a putative cytokine which is induced by stimulation via the CD2 structure on human T lymphocytes Eur J Immunol 19 1045 1051 PMID 2568930 DOI 10 1002 eji 1830190614 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Guan E Wang J Roderiquez G Norcross M A 2002 Natural truncation of the chemokine MIP 1beta CCL4 affects receptor specificity but not anti HIV 1 activity J Biol Chem 277 32348 32352 PMID 12070155 DOI 10 1074 jbc M203077200 Menten P Wuyts A Van Damme J 2002 Macrophage inflammatory protein 1 Cytokine Growth Factor Rev 13 455 481 PMID 12401480 DOI 10 1016 S1359 6101 02 00045 X Zipfel P F Balke J Irving S G Kelly K Siebenlist U 1989 Mitogenic activation of human T cells induces two closely related genes which share structural similarities with a new family of secreted factors J Immunol 142 1582 1590 PMID 2521882PrimitkiHuman PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10630 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 7 zhovtnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 17 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi