CCL3 (англ. C-C motif chemokine ligand 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 92 амінокислот, а молекулярна маса — 10 085.
CCL3 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CCL3, G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3, C-C motif chemokine ligand 3 | ||||||||||||||||
Зовнішні ІД | OMIM: 182283 MGI: 98260 HomoloGene: 88430 GeneCards: CCL3 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 17: 36.09 – 36.09 Mb | Хр. 11: 83.54 – 83.54 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MQVSTAALAV | LLCTMALCNQ | FSASLAADTP | TACCFSYTSR | QIPQNFIADY | ||||
FETSSQCSKP | GVIFLTKRSR | QVCADPSEEW | VQKYVSDLEL | SA |
Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах, як запальна відповідь, хемотаксис. Секретований назовні.
Література
- Blum S., Forsdyke R.E., Forsdyke D.R. (1990). Three human homologs of a murine gene encoding an inhibitor of stem cell proliferation. DNA Cell Biol. 9: 589—602. PMID 2271120 DOI:10.1089/dna.1990.9.589
- Nakao M., Nomiyama H., Shimada K. (1990). Structures of human genes coding for cytokine LD78 and their expression. Mol. Cell. Biol. 10: 3646—3658. PMID 1694014 DOI:10.1128/MCB.10.7.3646
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Koopmann W., Krangel M.S. (1997). Identification of a glycosaminoglycan-binding site in chemokine macrophage inflammatory protein-1alpha. J. Biol. Chem. 272: 10103—10109. PMID 9092555 DOI:10.1074/jbc.272.15.10103
- Guan E., Wang J., Roderiquez G., Norcross M.A. (2002). Natural truncation of the chemokine MIP-1beta/CCL4 affects receptor specificity but not anti-HIV-1 activity. J. Biol. Chem. 277: 32348—32352. PMID 12070155 DOI:10.1074/jbc.M203077200
- Menten P., Wuyts A., Van Damme J. (2002). Macrophage inflammatory protein-1. Cytokine Growth Factor Rev. 13: 455—481. PMID 12401480 DOI:10.1016/S1359-6101(02)00045-X
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:10627 (англ.) . Процитовано 12 вересня 2017.
{{}}
: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url () - UniProt, P10147 (англ.) . Архів оригіналу за 7 жовтня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CCL3 angl C C motif chemokine ligand 3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 92 aminokislot a molekulyarna masa 10 085 4 CCL3Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1B50 1B53 2X69 2X6G 3FPU 3H44 3KBX 4RA8 4ZKB 5D65 5CORIdentifikatoriSimvoliCCL3 G0S19 1 LD78ALPHA MIP 1 alpha MIP1A SCYA3 C C motif chemokine ligand 3Zovnishni ID OMIM 182283 MGI 98260 HomoloGene 88430 GeneCards CCL3Ontologiya genaMolekulyarna funkciya protein kinase activity cytokine activity CCR5 chemokine receptor binding chemokine activity CCR1 chemokine receptor binding kinase activity phospholipase activator activity calcium dependent protein kinase C activity GO 0001948 GO 0016582 protein binding identical protein binding chemoattractant activity CCR chemokine receptor bindingKlitinna komponenta citoplazma gialoplazma vnutrishnoklitinnij extracellular region mizhklitinnij prostirBiologichnij proces G protein coupled receptor signaling pathway signaling negative regulation of bone mineralization positive regulation of protein kinase B signaling release of sequestered calcium ion into cytosol by sarcoplasmic reticulum response to cholesterol positive regulation of calcium mediated signaling regulation of sensory perception of pain protein kinase B signaling monocyte chemotaxis negative regulation of osteoclast differentiation astrocyte cell migration positive regulation of cell migration positive regulation of natural killer cell chemotaxis chemokine mediated signaling pathway T cell chemotaxis cell cell signaling cellular response to tumor necrosis factor eosinophil chemotaxis GO 1904579 cellular response to organic cyclic compound cellular calcium ion homeostasis negative regulation of gene expression neutrophil chemotaxis cell activation MAPK cascade hemotaksis GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity positive regulation of neuron apoptotic process positive regulation of calcium ion import macrophage chemotaxis GO 1901313 positive regulation of gene expression cytoskeleton organization osteoblast differentiation cellular response to interleukin 1 GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid positive regulation of ERK1 and ERK2 cascade regulation of cell shape positive regulation of tumor necrosis factor production cellular response to interferon gamma lymphocyte chemotaxis inflammatory response granulocyte chemotaxis response to toxic substance eosinophil degranulation lipopolysaccharide mediated signaling pathway calcium ion transport calcium mediated signaling ekzocitoz positive regulation of calcium ion transport positive chemotaxis positive regulation of inflammatory response regulation of signaling receptor activity cytokine mediated signaling pathway regulation of behavior positive regulation of microglial cell activation positive regulation of microglial cell migrationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6348 20302Ensembl ENSG00000278567 ENSG00000277632 ENSG00000274221 ENSMUSG00000000982UniProt P10147 P10855RefSeq mRNK NM 002983NM 011337RefSeq bilok NP 002974NP 035467Lokus UCSC Hr 17 36 09 36 09 MbHr 11 83 54 83 54 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADY FETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do citokiniv Zadiyanij u takih biologichnih procesah yak zapalna vidpovid hemotaksis Sekretovanij nazovni Literaturared Blum S Forsdyke R E Forsdyke D R 1990 Three human homologs of a murine gene encoding an inhibitor of stem cell proliferation DNA Cell Biol 9 589 602 PMID 2271120 DOI 10 1089 dna 1990 9 589 Nakao M Nomiyama H Shimada K 1990 Structures of human genes coding for cytokine LD78 and their expression Mol Cell Biol 10 3646 3658 PMID 1694014 DOI 10 1128 MCB 10 7 3646 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Koopmann W Krangel M S 1997 Identification of a glycosaminoglycan binding site in chemokine macrophage inflammatory protein 1alpha J Biol Chem 272 10103 10109 PMID 9092555 DOI 10 1074 jbc 272 15 10103 Guan E Wang J Roderiquez G Norcross M A 2002 Natural truncation of the chemokine MIP 1beta CCL4 affects receptor specificity but not anti HIV 1 activity J Biol Chem 277 32348 32352 PMID 12070155 DOI 10 1074 jbc M203077200 Menten P Wuyts A Van Damme J 2002 Macrophage inflammatory protein 1 Cytokine Growth Factor Rev 13 455 481 PMID 12401480 DOI 10 1016 S1359 6101 02 00045 XPrimitkired Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10627 angl Procitovano 12 veresnya 2017 a href wiki D0 A8 D0 B0 D0 B1 D0 BB D0 BE D0 BD Cite web title Shablon Cite web cite web a Obslugovuvannya CS1 Storinki z parametrom url status ale bez parametra archive url posilannya UniProt P10147 angl Arhiv originalu za 7 zhovtnya 2017 Procitovano 12 veresnya 2017 Div takozhred Hromosoma 17 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title CCL3 amp oldid 43416547