CCL19 (англ. C-C motif chemokine ligand 19) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми. Довжина поліпептидного ланцюга білка становить 98 амінокислот, а молекулярна маса — 10 993.
CCL19 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CCL19, CKb11, ELC, MIP-3b, MIP3B, SCYA19, C-C motif chemokine ligand 19 | ||||||||||||||||
Зовнішні ІД | OMIM: 602227 MGI: 5434459 HomoloGene: 4569 GeneCards: CCL19 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 9: 34.69 – 34.69 Mb | Хр. 4: 42.07 – 42.07 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MALLLALSLL | VLWTSPAPTL | SGTNDAEDCC | LSVTQKPIPG | YIVRNFHYLL | ||||
IKDGCRVPAV | VFTTLRGRQL | CAPPDQPWVE | RIIQRLQRTS | AKMKRRSS |
Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах, як запальна відповідь, хемотаксис. Секретований назовні.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Rossi D.L., Vicari A.P., Franz-Bacon K., McClanahan T.K., Zlotnik A. (1997). Identification through bioinformatics of two new macrophage proinflammatory human chemokines: MIP-3alpha and MIP-3beta. J. Immunol. 158: 1033—1036. PMID 9013939
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:10617 (англ.) . Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 8 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до . |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CCL19 angl C C motif chemokine ligand 19 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 9 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 98 aminokislot a molekulyarna masa 10 993 CCL19Nayavni strukturiPDBPoshuk dlya lyudej PDBe RCSB Spisok kodiv PDB2MP1IdentifikatoriSimvoliCCL19 CKb11 ELC MIP 3b MIP3B SCYA19 C C motif chemokine ligand 19Zovnishni ID OMIM 602227 MGI 5434459 HomoloGene 4569 GeneCards CCL19Ontologiya genaMolekulyarna funkciya CCR10 chemokine receptor binding cytokine activity chemokine receptor binding CCR7 chemokine receptor binding chemokine activity CCR chemokine receptor binding GO 0001948 GO 0016582 protein bindingKlitinna komponenta extracellular region vnutrishnoklitinnij mizhklitinnij prostirBiologichnij proces release of sequestered calcium ion into cytosol positive regulation of receptor mediated endocytosis positive regulation of protein kinase B signaling positive regulation of cell motility positive regulation of dendritic cell dendrite assembly positive regulation of interleukin 12 production regulation of cell projection assembly monocyte chemotaxis positive regulation of T helper 1 cell differentiation chemokine mediated signaling pathway response to nitric oxide cellular response to tumor necrosis factor T cell costimulation response to virus cellular calcium ion homeostasis cell maturation myeloid dendritic cell chemotaxis positive regulation of JNK cascade dendritic cell chemotaxis positive regulation of phosphatidylinositol 3 kinase activity hemotaksis cell communication positive regulation of endocytosis GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity response to prostaglandin E positive regulation of dendritic cell antigen processing and presentation positive regulation of chemotaxis cellular response to interleukin 1 positive regulation of T cell proliferation GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid positive regulation of ERK1 and ERK2 cascade establishment of T cell polarity positive regulation of glycoprotein biosynthetic process cellular response to interferon gamma positive regulation of tumor necrosis factor production positive regulation of I kappaB kinase NF kappaB signaling lymphocyte chemotaxis positive regulation of neutrophil chemotaxis inflammatory response immunological synapse formation mature conventional dendritic cell differentiation positive regulation of protein kinase activity antimicrobial humoral immune response mediated by antimicrobial peptide regulation of signaling receptor activity G protein coupled receptor signaling pathway negative regulation of dendritic cell apoptotic process cytokine mediated signaling pathway positive regulation of NIK NF kappaB signaling neutrophil chemotaxisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6363 100861647Ensembl ENSG00000172724 ENSMUSG00000118633UniProt Q99731 n dRefSeq mRNK NM 006274XM 006538413RefSeq bilok NP 006265n dLokus UCSC Hr 9 34 69 34 69 MbHr 4 42 07 42 07 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLL IKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do citokiniv Zadiyanij u takih biologichnih procesah yak zapalna vidpovid hemotaksis Sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Rossi D L Vicari A P Franz Bacon K McClanahan T K Zlotnik A 1997 Identification through bioinformatics of two new macrophage proinflammatory human chemokines MIP 3alpha and MIP 3beta J Immunol 158 1033 1036 PMID 9013939PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10617 angl Procitovano 8 veresnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 9 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij