CCL18 (англ. C-C motif chemokine ligand 18) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 89 амінокислот, а молекулярна маса — 9 849.
CCL18 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CCL18, chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated), AMAC-1, AMAC1, CKb7, DC-CK1, DCCK1, MIP-4, PARC, SCYA18, C-C motif chemokine ligand 18 | ||||||||||||||||
Зовнішні ІД | OMIM: 603757 HomoloGene: 48154 GeneCards: CCL18 | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 17: 36.06 – 36.07 Mb | н/д | |||||||||||||||
PubMed search | н/д | ||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MKGLAAALLV | LVCTMALCSC | AQVGTNKELC | CLVYTSWQIP | QKFIVDYSET | ||||
SPQCPKPGVI | LLTKRGRQIC | ADPNKKWVQK | YISDLKLNA |
Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах, як запальна відповідь, хемотаксис. Секретований назовні.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Wells T.N.C., Peitsch M.C. (1997). The chemokine information source: identification and characterization of novel chemokines using the WorldWideWeb and expressed sequence tag databases. J. Leukoc. Biol. 61: 545—550. PMID 9129202
Примітки
- Human PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:10616 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 22 травня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CCL18 angl C C motif chemokine ligand 18 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 89 aminokislot a molekulyarna masa 9 849 CCL18Nayavni strukturiPDBPoshuk dlya lyudej PDBe RCSB Spisok kodiv PDB4MHEIdentifikatoriSimvoliCCL18 chemokine C C motif ligand 18 pulmonary and activation regulated AMAC 1 AMAC1 CKb7 DC CK1 DCCK1 MIP 4 PARC SCYA18 C C motif chemokine ligand 18Zovnishni ID OMIM 603757 HomoloGene 48154 GeneCards CCL18Ontologiya genaMolekulyarna funkciya cytokine activity GO 0001948 GO 0016582 protein binding CCR chemokine receptor binding chemokine activityKlitinna komponenta extracellular region mizhklitinnij prostirBiologichnij proces G protein coupled receptor signaling pathway monocyte chemotaxis chemokine mediated signaling pathway cellular response to tumor necrosis factor cell cell signaling neutrophil chemotaxis hemotaksis cell communication GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity cellular response to interleukin 1 GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid positive regulation of ERK1 and ERK2 cascade cellular response to interferon gamma lymphocyte chemotaxis inflammatory response GO 0072468 signalna transdukciya antimicrobial humoral immune response mediated by antimicrobial peptide regulation of signaling receptor activity positive regulation of inflammatory responseDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez6362 n dEnsembl ENSG00000275385 ENSG00000278167 ENSG00000278006 n dUniProt P55774 n dRefSeq mRNK NM 002988n dRefSeq bilok NP 002979n dLokus UCSC Hr 17 36 06 36 07 Mbn dPubMed search n dVikidaniDiv Red dlya lyudej Poslidovnist aminokislot1020304050 MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSET SPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do citokiniv Zadiyanij u takih biologichnih procesah yak zapalna vidpovid hemotaksis Sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Wells T N C Peitsch M C 1997 The chemokine information source identification and characterization of novel chemokines using the WorldWideWeb and expressed sequence tag databases J Leukoc Biol 61 545 550 PMID 9129202PrimitkiHuman PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10616 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 22 travnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 17 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi