Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
CCL11 (англ. C-C motif chemokine ligand 11) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 97 амінокислот, а молекулярна маса — 10 732.
| CCL11 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | CCL11, SCYA11, C-C motif chemokine ligand 11 | ||||||||||||||||
| Зовнішні ІД | OMIM: 601156 MGI: 103576 HomoloGene: 7929 GeneCards: CCL11 | ||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
 | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 17: 34.29 – 34.29 Mb | Хр. 11: 81.95 – 81.95 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MKVSAALLWL | LLIAAAFSPQ | GLAGPASVPT | TCCFNLANRK | IPLQRLESYR | ||||
| RITSGKCPQK | AVIFKTKLAK | DICADPKKKW | VQDSMKYLDQ | KSPTPKP |
Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах, як запальна відповідь, хемотаксис. Секретований назовні.
Література
- Garcia-Zepeda E.A., Rothenberg M.E., Ownbey T.R., Leder P., Luster A.D. (1996). Human eotaxin is a specific chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia. Nat. Med. 2: 449—456. PMID 8597956 DOI:10.1038/nm0496-449
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Crump M.P., Rajarathnam K., Kim K.S., Clark-Lewis I., Sykes B.D. (1998). Solution structure of eotaxin, a chemokine that selectively recruits eosinophils in allergic inflammation. J. Biol. Chem. 273: 22471—22479. PMID 9712872 DOI:10.1074/jbc.273.35.22471
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:10610 (англ.) . Процитовано 12 вересня 2017.
{{}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url () - UniProt, P51671 (англ.) . Архів оригіналу за 17 серпня 2017. Процитовано 12 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CCL11 angl C C motif chemokine ligand 11 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 97 aminokislot a molekulyarna masa 10 732 4 CCL11Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1EOT 2EOT 2MPMIdentifikatoriSimvoliCCL11 SCYA11 C C motif chemokine ligand 11Zovnishni ID OMIM 601156 MGI 103576 HomoloGene 7929 GeneCards CCL11Ontologiya genaMolekulyarna funkciya cytokine activity GO 0001948 GO 0016582 protein binding chemokine activity CCR3 chemokine receptor binding protein dimerization activity receptor ligand activity CCR chemokine receptor bindingKlitinna komponenta extracellular region mizhklitinnij prostir vnutrishnoklitinnijBiologichnij proces G protein coupled receptor signaling pathway positive regulation of endothelial cell proliferation positive regulation of actin filament polymerization response to interleukin 4 branching involved in mammary gland duct morphogenesis monocyte chemotaxis actin filament organization positive regulation of cell migration chemokine mediated signaling pathway response to interleukin 13 cellular response to tumor necrosis factor response to virus cellular calcium ion homeostasis mast cell chemotaxis neutrophil chemotaxis positive regulation of angiogenesis mammary duct terminal end bud growth hemotaksis protein phosphorylation GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity adgeziya klitin cytoskeleton organization cellular response to interleukin 1 GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid positive regulation of ERK1 and ERK2 cascade regulation of cell shape cellular response to interferon gamma lymphocyte chemotaxis response to radiation inflammatory response chronic inflammatory response GO 0072468 signalna transdukciya eosinophil chemotaxis antimicrobial humoral immune response mediated by antimicrobial peptide regulation of signaling receptor activity cytokine mediated signaling pathway ERK1 and ERK2 cascadeDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6356 20292Ensembl ENSG00000172156 ENSMUSG00000020676UniProt P51671 P48298RefSeq mRNK NM 002986NM 011330RefSeq bilok NP 002977NP 035460Lokus UCSC Hr 17 34 29 34 29 MbHr 11 81 95 81 95 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYR RITSGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do citokiniv Zadiyanij u takih biologichnih procesah yak zapalna vidpovid hemotaksis Sekretovanij nazovni Literaturared Garcia Zepeda E A Rothenberg M E Ownbey T R Leder P Luster A D 1996 Human eotaxin is a specific chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia Nat Med 2 449 456 PMID 8597956 DOI 10 1038 nm0496 449 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Crump M P Rajarathnam K Kim K S Clark Lewis I Sykes B D 1998 Solution structure of eotaxin a chemokine that selectively recruits eosinophils in allergic inflammation J Biol Chem 273 22471 22479 PMID 9712872 DOI 10 1074 jbc 273 35 22471Primitkired Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10610 angl Procitovano 12 veresnya 2017 a href wiki D0 A8 D0 B0 D0 B1 D0 BB D0 BE D0 BD Cite web title Shablon Cite web cite web a Obslugovuvannya CS1 Storinki z parametrom url status ale bez parametra archive url posilannya UniProt P51671 angl Arhiv originalu za 17 serpnya 2017 Procitovano 12 veresnya 2017 Div takozhred Hromosoma 17 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title CCL11 amp oldid 43416532