Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CAV1 англ Caveolin 1 білок який кодується однойменним геном розташованим у людей на короткому плечі 7 ї хромосоми Довжин

CAV1

CAV1

CAV1 (англ. Caveolin 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми. Довжина поліпептидного ланцюга білка становить 178 амінокислот, а молекулярна маса — 20 472.

CAV1
Ідентифікатори
Символи CAV1, BSCL3, CGL3, LCCNS, MSTP085, PPH3, VIP21, Caveolin 1
Зовнішні ІД OMIM: 601047 MGI: 102709 HomoloGene: 1330 GeneCards: CAV1
Пов'язані генетичні захворювання
congenital generalized lipodystrophy type 3
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
857
12389
Ensembl
ENSG00000105974
ENSMUSG00000007655
UniProt
Q03135
P49817
RefSeq (мРНК)
NM_001753
NM_001172895
NM_001172896
NM_001172897
NM_001243064
NM_007616
RefSeq (білок)
NP_001166366
NP_001166367
NP_001166368
NP_001744
NP_001229993
NP_031642
Локус (UCSC) Хр. 7: 116.52 – 116.56 Mb Хр. 6: 17.31 – 17.34 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID
LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFY
RLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSI
YVHTVCDPLFEAVGKIFSNVRINLQKEI

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, ацетилювання. Локалізований у клітинній мембрані, мембрані, апараті гольджі.

Література

  • Glenney J.R. Jr. (1992). The sequence of human caveolin reveals identity with VIP21, a component of transport vesicles. FEBS Lett. 314: 45—48. PMID 1360410 DOI:10.1016/0014-5793(92)81458-X
  • Engelman J.A., Zhang X.L., Lisanti M.P. (1999). Sequence and detailed organization of the human caveolin-1 and -2 genes located near the D7S522 locus (7q31.1). Methylation of a CpG island in the 5' promoter region of the caveolin-1 gene in human breast cancer cell lines. FEBS Lett. 448: 221—230. PMID 10218480 DOI:10.1016/S0014-5793(99)00365-8
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Vainonen J.P., Aboulaich N., Turkina M.V., Stralfors P., Vener A.V. (2004). N-terminal processing and modifications of caveolin-1 in caveolae from human adipocytes. Biochem. Biophys. Res. Commun. 320: 480—486. PMID 15219854 DOI:10.1016/j.bbrc.2004.05.196
  • Aboulaich N., Vainonen J.P., Stralfors P., Vener A.V. (2004). Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes. Biochem. J. 383: 237—248. PMID 15242332 DOI:10.1042/BJ20040647
  • Li S., Seitz R., Lisanti M.P. (1996). Phosphorylation of caveolin by src tyrosine kinases. The alpha-isoform of caveolin is selectively phosphorylated by v-Src in vivo. J. Biol. Chem. 271: 3863—3868. PMID 8632005 DOI:10.1074/jbc.271.7.3863

Примітки

  1. Захворювання, генетично пов'язані з CAV1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 26 жовтня 2017. Процитовано 7 вересня 2017.
  5. (англ.) . Архів оригіналу за 2 вересня 2017. Процитовано 7 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CAV1 angl Caveolin 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 7 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 178 aminokislot a molekulyarna masa 20 472 CAV1IdentifikatoriSimvoliCAV1 BSCL3 CGL3 LCCNS MSTP085 PPH3 VIP21 Caveolin 1Zovnishni ID OMIM 601047 MGI 102709 HomoloGene 1330 GeneCards CAV1Pov yazani genetichni zahvoryuvannyacongenital generalized lipodystrophy type 3 Ontologiya genaMolekulyarna funkciya protein macromolecule adaptor activity transmembrane transporter binding structural molecule activity signaling receptor binding nitric oxide synthase binding patched binding enzyme binding peptidase activator activity GO 0001948 GO 0016582 protein binding GO 0032947 molecular adaptor activity protein kinase binding ATPase binding cholesterol binding inward rectifier potassium channel inhibitor activity identical protein binding protein heterodimerization activity GO 0032403 protein containing complex bindingKlitinna komponenta endocytic vesicle membrane endosoma membrana focal adhesion VCP NPL4 UFD1 AAA ATPase complex perinuclear region of cytoplasm caveola vijka apical plasma membrane endoplazmatichnij retikulum membrane raft integral component of membrane kompleks Goldzhi early endosome membrane klitinna membrana vnutrishnoklitinnij cell cortex endoplasmic reticulum membrane Golgi membrane integral component of plasma membrane acrosomal membrane basolateral plasma membrane GO 0016023 cytoplasmic vesicle lipid droplet citoplazma GO 0009327 protein containing complex SarkolemaBiologichnij proces caveolin mediated endocytosis positive regulation of calcium ion transport into cytosol vazokonstrikciya response to progesterone negative regulation of protein binding regulation of peptidase activity protein localization to plasma membrane raft mammary gland development vaskulogenez negative regulation of pinocytosis response to ischemia Angiogenez apoptotic signaling pathway positive regulation of extrinsic apoptotic signaling pathway cholesterol homeostasis triglyceride metabolic process negative regulation of canonical Wnt signaling pathway calcium ion transport negative regulation of cell population proliferation cellular response to transforming growth factor beta stimulus positive regulation of toll like receptor 3 signaling pathway regulation of cytosolic calcium ion concentration regulation of smooth muscle contraction vesicle organization negative regulation of peptidyl tyrosine autophosphorylation regulation of cardiac muscle cell action potential involved in regulation of contraction negative regulation of transforming growth factor beta receptor signaling pathway protein localization to basolateral plasma membrane receptor internalization involved in canonical Wnt signaling pathway regulation of membrane repolarization during action potential positive regulation of peptidyl serine phosphorylation negative regulation of protein tyrosine kinase activity regulation of entry of bacterium into host cell negative regulation of MAP kinase activity positive regulation of vasoconstriction negative regulation of potassium ion transmembrane transport laktaciya receptor mediated endocytosis of virus by host cell regulation of blood coagulation regulation of ventricular cardiac muscle cell action potential protein homooligomerization GO 0022415 viral process positive regulation of intrinsic apoptotic signaling pathway negative regulation of receptor signaling pathway via JAK STAT mammary gland involution calcium ion homeostasis negative regulation of necroptotic process regulation of the force of heart contraction lipid storage nitric oxide homeostasis membrane depolarization negative regulation of cytokine mediated signaling pathway cellular calcium ion homeostasis GO 1901227 negative regulation of transcription by RNA polymerase II response to estrogen response to calcium ion regulation of fatty acid metabolic process cellular response to exogenous dsRNA negative regulation of MAPK cascade regulation of ruffle assembly positive regulation of protein binding positive regulation of protein ubiquitination negative regulation of anoikis leukocyte migration GO 0034613 protein localization positive regulation of cell adhesion molecule production response to hypoxia negative regulation of nitric oxide synthase activity response to bacterium caveola assembly cellular response to hyperoxia cholesterol transport cellular response to starvation T cell costimulation regulation of nitric oxide synthase activity receptor internalization positive regulation of peptidase activity positive regulation of ER associated ubiquitin dependent protein catabolic process negative regulation of endothelial cell proliferation negative regulation of BMP signaling pathway negative regulation of protein ubiquitination cellular response to peptide hormone stimulus GO 1901313 positive regulation of gene expression negative regulation of nitric oxide biosynthetic process angiotensin activated signaling pathway involved in heart process protein complex oligomerization negative regulation of peptidyl serine phosphorylation posttranscriptional regulation of gene expression positive regulation of gap junction assembly maintenance of protein location in cell negative regulation of signal transduction regulation of the force of heart contraction by chemical signal regulation of cell communication by electrical coupling involved in cardiac conduction regulation of heart rate by cardiac conduction negative regulation of epithelial cell differentiation skeletal muscle tissue development beta catenin destruction complex disassembly GO 0048554 positive regulation of catalytic activity positive regulation of canonical Wnt signaling pathway negative regulation of tyrosine phosphorylation of STAT protein negative regulation of inward rectifier potassium channel activity diferenciaciya klitin positive regulation of cell migration positive regulation of cold induced thermogenesis positive regulation of NF kappaB transcription factor activityDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez857 12389Ensembl ENSG00000105974 ENSMUSG00000007655UniProt Q03135 P49817RefSeq mRNK NM 001753 NM 001172895 NM 001172896 NM 001172897NM 001243064 NM 007616RefSeq bilok NP 001166366 NP 001166367 NP 001166368 NP 001744NP 001229993 NP 031642Lokus UCSC Hr 7 116 52 116 56 MbHr 6 17 31 17 34 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFY RLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSI YVHTVCDPLFEAVGKIFSNVRINLQKEI A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak vzayemodiya hazyayin virus acetilyuvannya Lokalizovanij u klitinnij membrani membrani aparati goldzhi LiteraturaGlenney J R Jr 1992 The sequence of human caveolin reveals identity with VIP21 a component of transport vesicles FEBS Lett 314 45 48 PMID 1360410 DOI 10 1016 0014 5793 92 81458 X Engelman J A Zhang X L Lisanti M P 1999 Sequence and detailed organization of the human caveolin 1 and 2 genes located near the D7S522 locus 7q31 1 Methylation of a CpG island in the 5 promoter region of the caveolin 1 gene in human breast cancer cell lines FEBS Lett 448 221 230 PMID 10218480 DOI 10 1016 S0014 5793 99 00365 8 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Vainonen J P Aboulaich N Turkina M V Stralfors P Vener A V 2004 N terminal processing and modifications of caveolin 1 in caveolae from human adipocytes Biochem Biophys Res Commun 320 480 486 PMID 15219854 DOI 10 1016 j bbrc 2004 05 196 Aboulaich N Vainonen J P Stralfors P Vener A V 2004 Vectorial proteomics reveal targeting phosphorylation and specific fragmentation of polymerase I and transcript release factor PTRF at the surface of caveolae in human adipocytes Biochem J 383 237 248 PMID 15242332 DOI 10 1042 BJ20040647 Li S Seitz R Lisanti M P 1996 Phosphorylation of caveolin by src tyrosine kinases The alpha isoform of caveolin is selectively phosphorylated by v Src in vivo J Biol Chem 271 3863 3868 PMID 8632005 DOI 10 1074 jbc 271 7 3863PrimitkiZahvoryuvannya genetichno pov yazani z CAV1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 26 zhovtnya 2017 Procitovano 7 veresnya 2017 angl Arhiv originalu za 2 veresnya 2017 Procitovano 7 veresnya 2017 Div takozhHromosoma 7 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ