Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

C1QC англ Complement C1q C chain білок який кодується однойменним геном розташованим у людей на 1 й хромосомі Довжина по

C1QC

C1QC

C1QC (англ. Complement C1q C chain) – білок, який кодується однойменним геном, розташованим у людей на 1-й хромосомі. Довжина поліпептидного ланцюга білка становить 245 амінокислот, а молекулярна маса — 25 774.

C1QC
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи C1QC, C1Q-C, C1QG, complement component 1, q subcomponent, C chain, complement C1q C chain
Зовнішні ІД OMIM: 120575 MGI: 88225 HomoloGene: 32020 GeneCards: C1QC
Ортологи
Види Людина Миша
Entrez
714
12262
Ensembl
ENSG00000159189
ENSMUSG00000036896
UniProt
P02747
Q02105
RefSeq (мРНК)
NM_172369
NM_001114101
NM_001347619
NM_001347620
NM_007574
RefSeq (білок)
NP_031600
Локус (UCSC) Хр. 1: 22.64 – 22.65 Mb Хр. 4: 136.62 – 136.62 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGY
DGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPG
PMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGD
YDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTN
QVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD

Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, шлях активації комплементу. Секретований назовні.

Література

  • Sellar G.C., Blake D.J., Reid K.B.M. (1991). Characterization and organization of the genes encoding the A-, B- and C-chains of human complement subcomponent C1q. The complete derived amino acid sequence of human C1q. Biochem. J. 274: 481—490. PMID 1706597 DOI:10.1042/bj2740481
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Reid K.B.M. (1979). Complete amino acid sequences of the three collagen-like regions present in subcomponent C1q of the first component of human complement. Biochem. J. 179: 367—371. PMID 486087 DOI:10.1042/bj1790367
  • Petry F. (1998). Molecular basis of hereditary C1q deficiency. Immunobiology. 199: 286—294. PMID 9777412

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:1245 (англ.) . Процитовано 15 вересня 2017.
  4. (англ.) . Архів оригіналу за 7 жовтня 2017. Процитовано 15 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

C1QC angl Complement C1q C chain bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na 1 j hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 245 aminokislot a molekulyarna masa 25 774 C1QCNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1PK6 2JG8 2JG9 2WNU 2WNV 5HZF 5HKJIdentifikatoriSimvoliC1QC C1Q C C1QG complement component 1 q subcomponent C chain complement C1q C chainZovnishni ID OMIM 120575 MGI 88225 HomoloGene 32020 GeneCards C1QCOntologiya genaMolekulyarna funkciya serine type endopeptidase activity GO 0001948 GO 0016582 protein bindingKlitinna komponenta extracellular region kolagen blood microparticle ekzosoma mizhklitinnij prostir collagen containing extracellular matrix sinaps postsynapseBiologichnij proces complement activation GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid negative regulation of granulocyte differentiation negative regulation of macrophage differentiation complement activation classical pathway proces imunnoyi sistemi vrodzhenij imunitet proteoliz regulation of complement activation synapse pruningDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez714 12262Ensembl ENSG00000159189 ENSMUSG00000036896UniProt P02747 Q02105RefSeq mRNK NM 172369 NM 001114101 NM 001347619 NM 001347620NM 007574RefSeq bilok NP 001107573 NP 001334548 NP 001334549 NP 758957 NP 001107573 1NP 758957 2NP 031600Lokus UCSC Hr 1 22 64 22 65 MbHr 4 136 62 136 62 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPDA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak imunitet vrodzhenij imunitet shlyah aktivaciyi komplementu Sekretovanij nazovni LiteraturaSellar G C Blake D J Reid K B M 1991 Characterization and organization of the genes encoding the A B and C chains of human complement subcomponent C1q The complete derived amino acid sequence of human C1q Biochem J 274 481 490 PMID 1706597 DOI 10 1042 bj2740481 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Reid K B M 1979 Complete amino acid sequences of the three collagen like regions present in subcomponent C1q of the first component of human complement Biochem J 179 367 371 PMID 486087 DOI 10 1042 bj1790367 Petry F 1998 Molecular basis of hereditary C1q deficiency Immunobiology 199 286 294 PMID 9777412PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1245 angl Procitovano 15 veresnya 2017 angl Arhiv originalu za 7 zhovtnya 2017 Procitovano 15 veresnya 2017 Div takozhHromosoma 1Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ