Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

C1QA англ Complement C1q A chain білок який кодується однойменним геном розташованим у людей на короткому плечі 1 ї хром

C1QA

C1QA

C1QA (англ. Complement C1q A chain) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 245 амінокислот, а молекулярна маса — 26 017.

C1QA
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи C1QA, complement C1q A chain
Зовнішні ІД OMIM: 120550 MGI: 88223 HomoloGene: 7249 GeneCards: C1QA
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
712
12259
Ensembl
ENSG00000173372
ENSMUSG00000036887
UniProt
P02745
P98086
RefSeq (мРНК)
NM_015991
NM_001347465
NM_001347466
NM_007572
RefSeq (білок)
NP_001334394
NP_001334395
NP_057075
NP_031598
Локус (UCSC) Хр. 1: 22.64 – 22.64 Mb Хр. 4: 136.62 – 136.63 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGE
QGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIK
GTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGR
FVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQV
VSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

Задіяний у таких біологічних процесах як імунітет, вроджений імунітет, шлях активації комплементу, поліморфізм. Секретований назовні.

Література

  • Sellar G.C., Blake D.J., Reid K.B.M. (1991). Characterization and organization of the genes encoding the A-, B- and C-chains of human complement subcomponent C1q. The complete derived amino acid sequence of human C1q. Biochem. J. 274: 481—490. PMID 1706597 DOI:10.1042/bj2740481
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Reid K.B.M. (1979). Complete amino acid sequences of the three collagen-like regions present in subcomponent C1q of the first component of human complement. Biochem. J. 179: 367—371. PMID 486087 DOI:10.1042/bj1790367
  • Reid K.B.M., Gagnon J., Frampton J. (1982). Completion of the amino acid sequences of the A and B chains of subcomponent C1q of the first component of human complement. Biochem. J. 203: 559—569. PMID 6981411 DOI:10.1042/bj2030559
  • Petry F. (1998). Molecular basis of hereditary C1q deficiency. Immunobiology. 199: 286—294. PMID 9777412

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:1241 (англ.) . Процитовано 25 серпня 2017.
  4. (англ.) . Архів оригіналу за 7 жовтня 2017. Процитовано 25 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

C1QA angl Complement C1q A chain bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 245 aminokislot a molekulyarna masa 26 017 C1QANayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1PK6 2JG8 2JG9 2WNU 2WNV 5HZF 5HKJIdentifikatoriSimvoliC1QA complement C1q A chainZovnishni ID OMIM 120550 MGI 88223 HomoloGene 7249 GeneCards C1QAOntologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding serine type endopeptidase activity amyloid beta bindingKlitinna komponenta extracellular region kolagen complement component C1 complex collagen containing extracellular matrix sinaps postsynapse amyloid beta complexBiologichnij proces proces imunnoyi sistemi complement activation cell cell signaling complement activation classical pathway response to iron ion vrodzhenij imunitet proteoliz regulation of complement activation GO 0010260 starinnya lyudini neuron remodeling synapse organization positive regulation of astrocyte activation synapse pruning complement mediated synapse pruning vertebrate eye specific patterning positive regulation of neuron death positive regulation of microglial cell activationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez712 12259Ensembl ENSG00000173372 ENSMUSG00000036887UniProt P02745 P98086RefSeq mRNK NM 015991 NM 001347465 NM 001347466NM 007572RefSeq bilok NP 001334394 NP 001334395 NP 057075NP 031598Lokus UCSC Hr 1 22 64 22 64 MbHr 4 136 62 136 63 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSAA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak imunitet vrodzhenij imunitet shlyah aktivaciyi komplementu polimorfizm Sekretovanij nazovni LiteraturaSellar G C Blake D J Reid K B M 1991 Characterization and organization of the genes encoding the A B and C chains of human complement subcomponent C1q The complete derived amino acid sequence of human C1q Biochem J 274 481 490 PMID 1706597 DOI 10 1042 bj2740481 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Reid K B M 1979 Complete amino acid sequences of the three collagen like regions present in subcomponent C1q of the first component of human complement Biochem J 179 367 371 PMID 486087 DOI 10 1042 bj1790367 Reid K B M Gagnon J Frampton J 1982 Completion of the amino acid sequences of the A and B chains of subcomponent C1q of the first component of human complement Biochem J 203 559 569 PMID 6981411 DOI 10 1042 bj2030559 Petry F 1998 Molecular basis of hereditary C1q deficiency Immunobiology 199 286 294 PMID 9777412PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1241 angl Procitovano 25 serpnya 2017 angl Arhiv originalu za 7 zhovtnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ