BTG2 (англ. BTG anti-proliferation factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 158 амінокислот, а молекулярна маса — 17 416.
BTG2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | BTG2, PC3, TIS21, BTG family member 2, BTG anti-proliferation factor 2, APRO1 | ||||||||||||||||
Зовнішні ІД | OMIM: 601597 MGI: 108384 HomoloGene: 31406 GeneCards: BTG2 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 203.31 – 203.31 Mb | Хр. 1: 134 – 134.01 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MSHGKGTDML | PEIAAAVGFL | SSLLRTRGCV | SEQRLKVFSG | ALQEALTEHY | ||||
KHHWFPEKPS | KGSGYRCIRI | NHKMDPIISR | VASQIGLSQP | QLHQLLPSEL | ||||
TLWVDPYEVS | YRIGEDGSIC | VLYEEAPLAA | SCGLLTCKNQ | VLLGRSSPSK | ||||
NYVMAVSS |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм.
Література
- Tirone F. (2001). The gene PC3(TIS21/BTG2), prototype member of the PC3/BTG/TOB family: regulator in control of cell growth, differentiation, and DNA repair?. J. Cell. Physiol. 187: 155—165. PMID 11267995 DOI:10.1002/jcp.1062
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Hong J.W., Ryu M.S., Lim I.K. (2005). Phosphorylation of serine 147 of tis21/BTG2/pc3 by p-Erk1/2 induces Pin-1 binding in cytoplasm and cell death. J. Biol. Chem. 280: 21256—21263. PMID 15788397 DOI:10.1074/jbc.M500318200
- Mauxion F., Faux C., Seraphin B. (2008). The BTG2 protein is a general activator of mRNA deadenylation. EMBO J. 27: 1039—1048. PMID 18337750 DOI:10.1038/emboj.2008.43
- Miyata S., Mori Y., Tohyama M. (2008). PRMT1 and Btg2 regulates neurite outgrowth of Neuro2a cells. Neurosci. Lett. 445: 162—165. PMID 18773938 DOI:10.1016/j.neulet.2008.08.065
- Doidge R., Mittal S., Aslam A., Winkler G.S. (2012). The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex. PLoS ONE. 7: E51331—E51331. PMID 23236473 DOI:10.1371/journal.pone.0051331
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 15 вересня 2015. Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 23 вересня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BTG2 angl BTG anti proliferation factor 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 158 aminokislot a molekulyarna masa 17 416 BTG2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3DJU 3E9VIdentifikatoriSimvoliBTG2 PC3 TIS21 BTG family member 2 BTG anti proliferation factor 2 APRO1Zovnishni ID OMIM 601597 MGI 108384 HomoloGene 31406 GeneCards BTG2Ontologiya genaMolekulyarna funkciya GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specific GO 0001948 GO 0016582 protein bindingKlitinna komponenta ekzosoma gialoplazma klitinne yadro citoplazmaBiologichnij proces GO 1904089 negative regulation of neuron apoptotic process negative regulation of translation positive regulation of nuclear transcribed mRNA poly A tail shortening associative learning GO 0009373 regulation of transcription DNA templated GO 1904578 response to organic cyclic compound dentate gyrus development negative regulation of neural precursor cell proliferation response to mechanical stimulus response to peptide hormone negative regulation of apoptotic process GO 1901227 negative regulation of transcription by RNA polymerase II response to electrical stimulus response to organic substance transcription DNA templated cellular response to DNA damage stimulus central nervous system neuron development response to organonitrogen compound neuron differentiation skeletal muscle cell differentiation neuron projection development GO 0100026 Reparaciya DNK anterior posterior pattern specification Metilyuvannya bilkiv negative regulation of cell population proliferation DNA damage response signal transduction by p53 class mediator resulting in cell cycle arrest negative regulation of mitotic cell cycleDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7832 12227Ensembl ENSG00000159388 ENSMUSG00000020423UniProt P78543 Q04211RefSeq mRNK NM 006763NM 007570RefSeq bilok NP 006754NP 031596Lokus UCSC Hr 1 203 31 203 31 MbHr 1 134 134 01 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHY KHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSEL TLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSK NYVMAVSS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi polimorfizm LiteraturaTirone F 2001 The gene PC3 TIS21 BTG2 prototype member of the PC3 BTG TOB family regulator in control of cell growth differentiation and DNA repair J Cell Physiol 187 155 165 PMID 11267995 DOI 10 1002 jcp 1062 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Hong J W Ryu M S Lim I K 2005 Phosphorylation of serine 147 of tis21 BTG2 pc3 by p Erk1 2 induces Pin 1 binding in cytoplasm and cell death J Biol Chem 280 21256 21263 PMID 15788397 DOI 10 1074 jbc M500318200 Mauxion F Faux C Seraphin B 2008 The BTG2 protein is a general activator of mRNA deadenylation EMBO J 27 1039 1048 PMID 18337750 DOI 10 1038 emboj 2008 43 Miyata S Mori Y Tohyama M 2008 PRMT1 and Btg2 regulates neurite outgrowth of Neuro2a cells Neurosci Lett 445 162 165 PMID 18773938 DOI 10 1016 j neulet 2008 08 065 Doidge R Mittal S Aslam A Winkler G S 2012 The anti proliferative activity of BTG TOB proteins is mediated via the Caf1a CNOT7 and Caf1b CNOT8 deadenylase subunits of the Ccr4 not complex PLoS ONE 7 E51331 E51331 PMID 23236473 DOI 10 1371 journal pone 0051331PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 15 veresnya 2015 Procitovano 28 serpnya 2017 angl Arhiv originalu za 23 veresnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi