BST2 (англ. Bone marrow stromal cell antigen 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 180 амінокислот, а молекулярна маса — 19 769.
BST2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | BST2, CD317, TETHERIN, Tetherin, bone marrow stromal cell antigen 2, HM1.24 | ||||||||||||||||
Зовнішні ІД | OMIM: 600534 MGI: 1916800 HomoloGene: 48277 GeneCards: BST2 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 19: 17.4 – 17.41 Mb | Хр. 8: 71.99 – 71.99 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MASTSYDYCR | VPMEDGDKRC | KLLLGIGILV | LLIIVILGVP | LIIFTIKANS | ||||
EACRDGLRAV | MECRNVTHLL | QQELTEAQKG | FQDVEAQAAT | CNHTVMALMA | ||||
SLDAEKAQGQ | KKVEELEGEI | TTLNHKLQDA | SAEVERLRRE | NQVLSVRIAD | ||||
KKYYPSSQDS | SSAAAPQLLI | VLLGLSALLQ |
Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, противірусний захист. Локалізований у клітинній мембрані, цитоплазмі, мембрані, апараті гольджі, ендосомах.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Neil S.J., Zang T., Bieniasz P.D. (2008). Tetherin inhibits retrovirus release and is antagonized by HIV-1 Vpu. Nature. 451: 425—430. PMID 18200009 DOI:10.1038/nature06553
- Gupta R.K., Towers G.J. (2009). A tail of Tetherin: how pandemic HIV-1 conquered the world. Cell Host Microbe. 6: 393—395. PMID 19917491 DOI:10.1016/j.chom.2009.11.002
- Le Tortorec A., Neil S.J. (2009). Antagonism to and intracellular sequestration of human tetherin by the human immunodeficiency virus type 2 envelope glycoprotein. J. Virol. 83: 11966—11978. PMID 19740980 DOI:10.1128/JVI.01515-09
- Kaletsky R.L., Francica J.R., Agrawal-Gamse C., Bates P. (2009). Tetherin-mediated restriction of filovirus budding is antagonized by the Ebola glycoprotein. Proc. Natl. Acad. Sci. U.S.A. 106: 2886—2891. PMID 19179289 DOI:10.1073/pnas.0811014106
- Andrew A.J., Miyagi E., Kao S., Strebel K. (2009). The formation of cysteine-linked dimers of BST-2/tetherin is important for inhibition of HIV-1 virus release but not for sensitivity to Vpu. Retrovirology. 6: 80—80. PMID 19737401 DOI:10.1186/1742-4690-6-80
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1119 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 24 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BST2 angl Bone marrow stromal cell antigen 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 180 aminokislot a molekulyarna masa 19 769 BST2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2LK9 2X7A 2XG7 3MQ7 3MQ9 3MQB 3MQC 3NWH 4P6ZIdentifikatoriSimvoliBST2 CD317 TETHERIN Tetherin bone marrow stromal cell antigen 2 HM1 24Zovnishni ID OMIM 600534 MGI 1916800 HomoloGene 48277 GeneCards BST2Ontologiya genaMolekulyarna funkciya protein homodimerization activity signal transducer activity GO 0001948 GO 0016582 protein binding metalloendopeptidase inhibitor activity RNA binding identical protein bindingKlitinna komponenta citoplazma integral component of membrane multivesicular body endosoma late endosome kompleks Goldzhi membrana klitinna membrana integral component of plasma membrane cell surface apical plasma membrane membrane raft anchored component of membrane ekzosoma gialoplazma azurophil granule membraneBiologichnij proces negative regulation of intracellular transport of viral material regulation of actin cytoskeleton organization response to interferon gamma proces imunnoyi sistemi cell cell signaling response to virus response to interferon beta multicellular organism development B cell activation negative regulation of viral genome replication negative regulation of cell migration humoral immune response defense response to virus type I interferon signaling pathway negative regulation of cell growth negative regulation of plasmacytoid dendritic cell cytokine production response to interferon alpha positive regulation of I kappaB kinase NF kappaB signaling proliferaciya vrodzhenij imunitet negative regulation of endopeptidase activity neutrophil degranulationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez684 69550Ensembl ENSG00000130303 ENSMUSG00000046718UniProt Q10589 Q8R2Q8RefSeq mRNK NM 004335NM 198095RefSeq bilok NP 004326NP 932763Lokus UCSC Hr 19 17 4 17 41 MbHr 8 71 99 71 99 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANS EACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMA SLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIAD KKYYPSSQDSSSAAAPQLLIVLLGLSALLQ A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Zadiyanij u takih biologichnih procesah yak imunitet vrodzhenij imunitet protivirusnij zahist Lokalizovanij u klitinnij membrani citoplazmi membrani aparati goldzhi endosomah LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Neil S J Zang T Bieniasz P D 2008 Tetherin inhibits retrovirus release and is antagonized by HIV 1 Vpu Nature 451 425 430 PMID 18200009 DOI 10 1038 nature06553 Gupta R K Towers G J 2009 A tail of Tetherin how pandemic HIV 1 conquered the world Cell Host Microbe 6 393 395 PMID 19917491 DOI 10 1016 j chom 2009 11 002 Le Tortorec A Neil S J 2009 Antagonism to and intracellular sequestration of human tetherin by the human immunodeficiency virus type 2 envelope glycoprotein J Virol 83 11966 11978 PMID 19740980 DOI 10 1128 JVI 01515 09 Kaletsky R L Francica J R Agrawal Gamse C Bates P 2009 Tetherin mediated restriction of filovirus budding is antagonized by the Ebola glycoprotein Proc Natl Acad Sci U S A 106 2886 2891 PMID 19179289 DOI 10 1073 pnas 0811014106 Andrew A J Miyagi E Kao S Strebel K 2009 The formation of cysteine linked dimers of BST 2 tetherin is important for inhibition of HIV 1 virus release but not for sensitivity to Vpu Retrovirology 6 80 80 PMID 19737401 DOI 10 1186 1742 4690 6 80PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1119 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 24 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi