BMP4 (англ. Bone morphogenetic protein 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми. Довжина поліпептидного ланцюга білка становить 408 амінокислот, а молекулярна маса — 46 555.
BMP4 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | BMP4, BMP2B, BMP2B1, MCOPS6, OFC11, ZYME, bone morphogenetic protein 4 | ||||||||||||||||
Зовнішні ІД | OMIM: 112262 MGI: 88180 HomoloGene: 7247 GeneCards: BMP4 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | н/д | Хр. 14: 46.62 – 46.63 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MIPGNRMLMV | VLLCQVLLGG | ASHASLIPET | GKKKVAEIQG | HAGGRRSGQS | ||||
HELLRDFEAT | LLQMFGLRRR | PQPSKSAVIP | DYMRDLYRLQ | SGEEEEEQIH | ||||
STGLEYPERP | ASRANTVRSF | HHEEHLENIP | GTSENSAFRF | LFNLSSIPEN | ||||
EVISSAELRL | FREQVDQGPD | WERGFHRINI | YEVMKPPAEV | VPGHLITRLL | ||||
DTRLVHHNVT | RWETFDVSPA | VLRWTREKQP | NYGLAIEVTH | LHQTRTHQGQ | ||||
HVRISRSLPQ | GSGNWAQLRP | LLVTFGHDGR | GHALTRRRRA | KRSPKHHSQR | ||||
ARKKNKNCRR | HSLYVDFSDV | GWNDWIVAPP | GYQAFYCHGD | CPFPLADHLN | ||||
STNHAIVQTL | VNSVNSSIPK | ACCVPTELSA | ISMLYLDEYD | KVVLKNYQEM | ||||
VVEGCGCR |
Кодований геном білок за функціями належить до цитокінів, факторів росту, , фосфопротеїнів. Задіяний у таких біологічних процесах, як остеогенез, диференціація клітин. Локалізований у позаклітинному матриксі. Також секретований назовні.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Oida S., Iimura T., Maruoka Y., Takeda K., Sasaki S. (1995). Cloning and sequence of bone morphogenetic protein 4 (BMP-4) from a human placental cDNA library. DNA Seq. 5: 273—275. PMID 7579580 DOI:10.3109/10425179509030980
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 12 червня 2017. Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 17 вересня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BMP4 angl Bone morphogenetic protein 4 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 14 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 408 aminokislot a molekulyarna masa 46 555 BMP4IdentifikatoriSimvoliBMP4 BMP2B BMP2B1 MCOPS6 OFC11 ZYME bone morphogenetic protein 4Zovnishni ID OMIM 112262 MGI 88180 HomoloGene 7247 GeneCards BMP4Ontologiya genaMolekulyarna funkciya heparin binding cytokine activity co receptor binding transforming growth factor beta receptor binding growth factor activity BMP receptor binding GO 0001948 GO 0016582 protein binding chemoattractant activityKlitinna komponenta extracellular region mizhklitinnij prostir endoplasmic reticulum lumenBiologichnij proces embryonic skeletal system morphogenesis negative regulation of T cell differentiation in thymus germ cell development skeletal system development mesenchymal cell differentiation involved in renal system development cardiac septum development ureteric bud development positive regulation of protein phosphorylation renal system process positive regulation of endothelial cell differentiation negative regulation of immature T cell proliferation in thymus bud elongation involved in lung branching tendon cell differentiation anatomical structure formation involved in morphogenesis ureter epithelial cell differentiation negative regulation of cell cycle mesenchymal to epithelial transition involved in metanephros morphogenesis trachea development post embryonic development monocyte differentiation specification of ureteric bud anterior posterior symmetry by BMP signaling pathway blood vessel endothelial cell proliferation involved in sprouting angiogenesis BMP signaling pathway involved in renal system segmentation cranial suture morphogenesis mesonephros development odontogenesis of dentin containing tooth telencephalon regionalization negative regulation of chondrocyte differentiation blood vessel development negative regulation of mitotic nuclear division Angiogenez prostate gland morphogenesis positive regulation of ERK1 and ERK2 cascade smooth muscle tissue development BMP signaling pathway involved in heart induction negative regulation of epithelial cell proliferation gistogenez metanephric collecting duct development inner ear receptor cell differentiation mesodermal cell fate determination metanephros development type B pancreatic cell development regulation of pathway restricted SMAD protein phosphorylation negative regulation of cell population proliferation steroid hormone mediated signaling pathway mammary gland formation positive regulation of collagen biosynthetic process renal system development negative regulation of myoblast differentiation cell fate commitment common partner SMAD protein phosphorylation glomerular visceral epithelial cell development SMAD protein signal transduction osifikaciya rozvitok nirki lung development ureter smooth muscle cell differentiation embryonic digit morphogenesis epithelial mesenchymal cell signaling negative regulation of thymocyte apoptotic process mesenchymal cell differentiation involved in kidney development negative regulation of cell death regulation of odontogenesis of dentin containing tooth BMP signaling pathway involved in ureter morphogenesis mesenchymal cell proliferation involved in ureteric bud development smooth muscle cell differentiation lymphoid progenitor cell differentiation epithelium development GO 0060469 GO 0009371 positive regulation of transcription DNA templated deltoid tuberosity development negative regulation of prostatic bud formation heart development telencephalon development branching involved in ureteric bud morphogenesis positive regulation of kidney development cartilage development embryonic limb morphogenesis negative regulation of MAP kinase activity positive regulation of cartilage development lens induction in camera type eye positive regulation of neuron differentiation branching involved in prostate gland morphogenesis regulation of protein import into nucleus positive regulation of cell differentiation erythrocyte differentiation smoothened signaling pathway camera type eye development secondary heart field specification negative regulation of phosphorylation regulation of smooth muscle cell differentiation regulation of cell fate commitment regulation of branching involved in prostate gland morphogenesis diferenciaciya klitin positive regulation of branching involved in lung morphogenesis chondrocyte differentiation regulation of cartilage development organ induction positive regulation of epithelial cell proliferation epithelial cell proliferation involved in lung morphogenesis negative regulation of cell proliferation involved in heart morphogenesis negative regulation of apoptotic process positive regulation of ossification osifikaciya endohondralna regulation of smooth muscle cell proliferation regulation of morphogenesis of a branching structure BMP signaling pathway macrophage differentiation negative regulation of metanephric comma shaped body morphogenesis embryonic skeletal system development mesenchymal cell proliferation involved in ureter development osteoblast differentiation hematopoietic progenitor cell differentiation positive regulation of BMP signaling pathway regulyaciya ekspresiyi geniv embryonic cranial skeleton morphogenesis dorsal ventral neural tube patterning lung alveolus development positive regulation of protein binding anterior posterior axis specification GO 0045996 negative regulation of transcription DNA templated positive regulation of epidermal cell differentiation branching morphogenesis of an epithelial tube trachea formation specification of animal organ position negative regulation of glomerular mesangial cell proliferation positive regulation of smooth muscle cell proliferation intermediate mesodermal cell differentiation pulmonary artery endothelial tube morphogenesis pituitary gland development positive regulation of cell death lung morphogenesis positive regulation of endothelial cell proliferation bud dilation involved in lung branching positive regulation of cardiac muscle fiber development negative regulation of striated muscle tissue development positive regulation of cell migration negative regulation of branch elongation involved in ureteric bud branching by BMP signaling pathway BMP signaling pathway involved in nephric duct formation positive regulation of pathway restricted SMAD protein phosphorylation negative regulation of mesenchymal cell proliferation involved in ureter development mesoderm formation cellular response to growth factor stimulus glomerular capillary formation bronchus development positive regulation of endothelial cell migration multicellular organism development negative regulation of metanephric S shaped body morphogenesis neural tube closure vasculature development embryonic morphogenesis protein localization to nucleus positive regulation of apoptotic process embryonic skeletal joint morphogenesis regulyaciya diferenciyuvannya klitin negative regulation of branching involved in ureteric bud morphogenesis mesodermal cell differentiation neuron fate commitment forebrain development cloacal septation bone development camera type eye morphogenesis positive regulation of SMAD protein signal transduction negative regulation of glomerulus development embryonic hindlimb morphogenesis positive chemotaxis outflow tract morphogenesis odontogenesis GO 1901227 negative regulation of transcription by RNA polymerase II epithelial to mesenchymal transition involved in endocardial cushion formation cardiac jelly development cellular response to BMP stimulus positive regulation of osteoblast differentiation epithelial tube branching involved in lung morphogenesis cardiac muscle cell differentiation apoptotic process involved in endocardial cushion morphogenesis muscular septum morphogenesis GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of bone mineralization cardiac right ventricle morphogenesis outflow tract septum morphogenesis membranous septum morphogenesis aortic valve morphogenesis pulmonary valve morphogenesis endocardial cushion development endoderm development coronary vasculature development BMP signaling pathway involved in heart development pharyngeal arch artery morphogenesis positive regulation of cell proliferation involved in outflow tract morphogenesis negative regulation of extrinsic apoptotic signaling pathway regulation of pri miRNA transcription by RNA polymerase II positive regulation of production of miRNAs involved in gene silencing by miRNA posttranslyacijna modifikaciya GO 1901313 positive regulation of gene expression positive regulation of epithelial to mesenchymal transition positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis regulation of signaling receptor activity positive regulation of cell population proliferation negative regulation of gene expression negative regulation of pri miRNA transcription by RNA polymerase II regulation of apoptotic process regulation of MAPK cascade rozvitok klitin ristDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez652 12159Ensembl ENSG00000125378 ENSMUSG00000021835UniProt P12644 P21275RefSeq mRNK NM 001202 NM 130850 NM 130851NM 007554 NM 001316360RefSeq bilok NP 001193 NP 570911 NP 001334841 NP 001334842 NP 001334843NP 001334844 NP 001334845 NP 001334846 NP 570912NP 001303289 NP 031580Lokus UCSC n dHr 14 46 62 46 63 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQS HELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIH STGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPEN EVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLL DTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQ HVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQR ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLN STNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEM VVEGCGCR A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do citokiniv faktoriv rostu fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak osteogenez diferenciaciya klitin Lokalizovanij u pozaklitinnomu matriksi Takozh sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Oida S Iimura T Maruoka Y Takeda K Sasaki S 1995 Cloning and sequence of bone morphogenetic protein 4 BMP 4 from a human placental cDNA library DNA Seq 5 273 275 PMID 7579580 DOI 10 3109 10425179509030980PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 12 chervnya 2017 Procitovano 11 veresnya 2017 angl Arhiv originalu za 17 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 14 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi