BMP2 (англ. Bone morphogenetic protein 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. Довжина поліпептидного ланцюга білка становить 396 амінокислот, а молекулярна маса — 44 702.
BMP2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | BMP2, BDA2, BMP2A, bone morphogenetic protein 2, SSFSC, SSFSC1 | ||||||||||||||||
Зовнішні ІД | OMIM: 112261 MGI: 88177 HomoloGene: 926 GeneCards: BMP2 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
ожиріння, brachydactyly type A2 | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 20: 6.77 – 6.78 Mb | Хр. 2: 133.39 – 133.4 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MVAGTRCLLA | LLLPQVLLGG | AAGLVPELGR | RKFAAASSGR | PSSQPSDEVL | ||||
SEFELRLLSM | FGLKQRPTPS | RDAVVPPYML | DLYRRHSGQP | GSPAPDHRLE | ||||
RAASRANTVR | SFHHEESLEE | LPETSGKTTR | RFFFNLSSIP | TEEFITSAEL | ||||
QVFREQMQDA | LGNNSSFHHR | INIYEIIKPA | TANSKFPVTR | LLDTRLVNQN | ||||
ASRWESFDVT | PAVMRWTAQG | HANHGFVVEV | AHLEEKQGVS | KRHVRISRSL | ||||
HQDEHSWSQI | RPLLVTFGHD | GKGHPLHKRE | KRQAKHKQRK | RLKSSCKRHP | ||||
LYVDFSDVGW | NDWIVAPPGY | HAFYCHGECP | FPLADHLNST | NHAIVQTLVN | ||||
SVNSKIPKAC | CVPTELSAIS | MLYLDENEKV | VLKNYQDMVV | EGCGCR |
Кодований геном білок за функціями належить до цитокінів, факторів росту, . Задіяний у таких біологічних процесах, як остеогенез, диференціація клітин. Секретований назовні.
Література
- Yeung B., Porter T.J., Vath J.E. (1997). Direct isoform analysis of high-mannose-containing glycoproteins by on-line capillary electrophoresis electrospray mass spectrometry. Anal. Chem. 69: 2510—2516. PMID 9265423 DOI:10.1021/ac9611172
- Scheufler C., Sebald W., Huelsmeyer M. (1999). Crystal structure of human bone morphogenetic protein-2 at 2.7 A resolution. J. Mol. Biol. 287: 103—115. PMID 10074410 DOI:10.1006/jmbi.1999.2590
Примітки
- Захворювання, генетично пов'язані з BMP2 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 28 травня 2017. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BMP2 angl Bone morphogenetic protein 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 396 aminokislot a molekulyarna masa 44 702 BMP2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1ES7 1REU 1REW 2GOO 2H62 2H64 2QJ9 2QJA 2QJB 3BK3 3BMP 4MID 4N1D 4UHY 4UHZ 4UI0 4UI1 4UI2IdentifikatoriSimvoliBMP2 BDA2 BMP2A bone morphogenetic protein 2 SSFSC SSFSC1Zovnishni ID OMIM 112261 MGI 88177 HomoloGene 926 GeneCards BMP2Pov yazani genetichni zahvoryuvannyaozhirinnya brachydactyly type A2 Ontologiya genaMolekulyarna funkciya signaling receptor binding cytokine activity co receptor binding phosphatase activator activity growth factor activity BMP receptor binding GO 0001948 GO 0016582 protein binding NAD retinol dehydrogenase activity SMAD binding protein heterodimerization activity transforming growth factor beta receptor bindingKlitinna komponenta extracellular region cell surface BMP receptor complex mizhklitinnij prostir vnutrishnoklitinna membranna organelaBiologichnij proces skeletal system development positive regulation of Wnt signaling pathway by BMP signaling pathway positive regulation of protein phosphorylation mesenchyme development negative regulation of cell cycle odontogenesis of dentin containing tooth telencephalon regionalization protein phosphorylation atrioventricular valve morphogenesis proteoglycan metabolic process mesenchymal cell differentiation pericardium development positive regulation of ERK1 and ERK2 cascade BMP signaling pathway involved in heart induction animal organ morphogenesis inner ear development cardiocyte differentiation negative regulation of canonical Wnt signaling pathway negative regulation of cell population proliferation positive regulation of p38MAPK cascade pathway restricted SMAD protein phosphorylation cell fate commitment GO 0009373 regulation of transcription DNA templated SMAD protein signal transduction osifikaciya in utero embryonic development mesenchymal cell proliferation involved in ureteric bud development regulation of odontogenesis of dentin containing tooth GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of Wnt signaling pathway heart development telencephalon development branching involved in ureteric bud morphogenesis negative regulation of Wnt signaling pathway involved in heart development cartilage development bone mineralization involved in bone maturation positive regulation of cartilage development positive regulation of neuron differentiation positive regulation of cell differentiation thyroid stimulating hormone secreting cell differentiation inflammatory response positive regulation of fat cell differentiation negative regulation of steroid biosynthetic process positive regulation of MAPK cascade Signalnij shlyah Notch bone mineralization diferenciaciya klitin chondrocyte differentiation corticotropin hormone secreting cell differentiation positive regulation of astrocyte differentiation positive regulation of bone mineralization GO 1904579 cellular response to organic cyclic compound positive regulation of ossification GO 1901227 negative regulation of transcription by RNA polymerase II positive regulation of epithelial to mesenchymal transition positive regulation of phosphatase activity negative regulation of calcium independent cell cell adhesion positive regulation of osteoblast differentiation protein destabilization embryonic heart tube anterior posterior pattern specification osteoblast differentiation Epitelialno mezenhimalnij perehid positive regulation of protein binding GO 0045996 negative regulation of transcription DNA templated positive regulation of odontogenesis GO 0007329 positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus negative regulation of aldosterone biosynthetic process positive regulation of osteoblast proliferation response to hypoxia positive regulation of endothelial cell proliferation positive regulation of cell migration negative regulation of cortisol biosynthetic process cell cell signaling positive regulation of pathway restricted SMAD protein phosphorylation cellular response to growth factor stimulus cellular response to BMP stimulus cardiac muscle tissue morphogenesis endocardial cushion morphogenesis multicellular organism development negative regulation of cardiac muscle cell differentiation positive regulation of apoptotic process negative regulation of insulin like growth factor receptor signaling pathway GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II cardiac epithelial to mesenchymal transition positive regulation of pri miRNA transcription by RNA polymerase II GO 1901313 positive regulation of gene expression BMP signaling pathway cardiac muscle cell differentiation rozvitok klitin regulation of signaling receptor activity negative regulation of gene expression response to bacterium regulation of apoptotic process regulation of MAPK cascadeDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez650 12156Ensembl ENSG00000125845 ENSMUSG00000027358UniProt P12643 P21274RefSeq mRNK NM 001200NM 007553RefSeq bilok NP 001191NP 031579Lokus UCSC Hr 20 6 77 6 78 MbHr 2 133 39 133 4 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVL SEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLE RAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAEL QVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQN ASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSL HQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVN SVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do citokiniv faktoriv rostu Zadiyanij u takih biologichnih procesah yak osteogenez diferenciaciya klitin Sekretovanij nazovni LiteraturaYeung B Porter T J Vath J E 1997 Direct isoform analysis of high mannose containing glycoproteins by on line capillary electrophoresis electrospray mass spectrometry Anal Chem 69 2510 2516 PMID 9265423 DOI 10 1021 ac9611172 Scheufler C Sebald W Huelsmeyer M 1999 Crystal structure of human bone morphogenetic protein 2 at 2 7 A resolution J Mol Biol 287 103 115 PMID 10074410 DOI 10 1006 jmbi 1999 2590PrimitkiZahvoryuvannya genetichno pov yazani z BMP2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 28 travnya 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 25 serpnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 20 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi